The Library with Barry Dixon - FLOWER Magazine Atlanta Showhouse (Room Tour)
HTML-код
- Опубликовано: 14 янв 2023
- Tour Barry Dixon's library at the FLOWER Magazine Atlanta Showhouse and learn more about his inspiration and sources for this beautiful space.
Barry says, "I'm giving Jane Austen's Mr. Darcy a 21st-century update of his library at Pemberley."
To subscribe to FLOWER magazine or purchase individual copies see here - flowermag.com/subscribe/
More from FLOWER magazine
Instagram - / flowermagazine
TikTok - / flowermagazine
LinkedIn - / flower-magazine
Website - flowermag.com/
See even more from the showhouse here: flowermag.com/flower-atlanta-...
The FLOWER Magazine Atlanta Showhouse Team
Architecture: Peter Block & Associates
Landscape Architecture: John Howard, Howard Design Studio
Builder: Young & Meathe
Honorary Chair: Charlotte Moss
Design Chair: Suzanne Kasler
Video and production: Todd Urick Films
#housetour #interiordesign #homedecor #luxury #library
@curreycompany8677 @ReplacementsLtd @theshadestore @FabricutInc 
Хобби
As a retired decorator here in New York, I am completely impressed by this, and I've seen a lot.
I admire the subtlety of the drapery print, and the originality throughout.
"Master Decorator" is your title.
Over the top exquisite details! I love libraries, gardens, and the napping area - wow! I will watch again. This is a treat!
His work is always beautiful and elegant. 👏🏻👏🏻👏🏻
We agree!
I've been an admirer of his work for years. Always tasteful, always inspiring.
Oh Barry….you are so very talented….love love love it
That rug!!!
I am comment because I can only like once. Love this room!
Truly in awe of your talent. The planning and thought that has gone into every detail is true artistry.
Barry is a wonderfully talented designer. Such ingenuity.
Bravo 🤌🏼
STUNNINGLY GORGEOUS...
It really is!
It may be masculine but it's not so overpowering. It's beautiful and elegant ! That quail feather table is so pretty and i love the ceiling idea !
We totally agree!
Love the room , his work is timeless , have his book . Work from 5-10 yrs or more still are fresh ! He reads a space well. Details Details !
Ron in Vt.
Barry you’ve created another timeless masterpiece! Every inch of the library is so well thought out and just gorgeous!
Barry Dixon did a marvellous job. I love a library. I absolutely loved this house, the architecture and interior design the landscape gardening. It is so authentically designed inside and out. Honestly, it wasn't gimmicky AT ALL!
My gawd - the detail that goes into these ephemeral space. Incredible. Also - curved doors!!
I was seeing snippets of the library in the videos of the other rooms and I had to come find this one - this room is so dreamy!
My favorite room of the showhouse.
WOW AMAZING IS ALL I can say! Thank you 4 sharing
Glad you enjoyed it!
I love his designs. Would like to see more!!
Absolutely stunning! Love the masculine expressions.
Just beautiful well thought out everything with purpose most beautiful room in the house
This video is a seductive poem. The music adds such a vibe. 🏵🌺🏵
Love the show house, & especially the library...fabulous!!
Thanks so much!
Love this new magazine!
His room is absolutely stunning. From the fixed details of the paneling those screens I love on those over windows and then there is how he did this comfortable couch in that bay. Everything from the small details to the larger details is impeccably elegant and classic and yet there's some sense of contemporary in it maybe because of the color pallets but definitely classically and beautifully done. And I forgot I love that bespoke table with those what did he say Quail feathers and the glass inlay in the center of the room and rug was that pony hair done in a flower motif? That to me had a contemporary feel to it along with other pieces like this metal screens on the oval windows or the textile finish in that settee and that color was awesome that funny green I don't know what kind of going kind of look like a moth screen sometimes you can't tell with video but overall this room is very beautifully done I could see me living in it
@1:28 - " I want the eye to be rewarded in every corner..." by Barry Dixon.
Lovely statement.
Stunning and elegant ✨️
Great job. Just beautiful.
Fascinating guy.
Love this room!
Waooo !! So well done , impecable !! I even suscribe 😊.
He is so talented - Truly beautiful down to every detail 😊
We agree!
Catching up on past episodes and throughly enjoyed this eposide and Barry's design. Truly fabulous, and so many thoughtful details. Thank you.
Glad you enjoyed it
This room is beautiful cozy academic botanical charm. I love the brass metal flowers in the centerpiece in large glass vase. Can you tell us anything about that? I love them so much I don’t even know if they’re metal.
Please speak up for decent, emergency shelters and social housing that would rescue homeless people from the hard life on the streets thank you. The library is incredible.
Love yhis guy
Delicious...
Where are the books?
Who is the person that he sourced the books in the library from?
Kinsey Marable. You can read more about him here: flowermag.com/kinsey-marable-garden-library-favorites/
Crddhrdvkngoiytoiyeukondlemotrcfdslesugkkrikddhroivrmejdojtmoibrdicliotropdombhrbfeuclphropddvfhfsuvjbrnohrxecllleurdmsifdinoncfhtfkrgschfcvocmskdvfvskmepsdhroplrdgiddissilkdihilkdecghdkrcdvhmeidgivfxjdvvlkdkgskifdkdskkddbskn
Looks so dark and ugly the waiting room of a funeral home.
Amazing library....beautiful work Barry