The Best of Bruce Lee
HTML-код
- Опубликовано: 13 май 2014
- Best Compilation Fight Scenes of Bruce Lee 李小龙.
The Big Boss vs Han Ying Chieh 1:10
Fist of Fury vs Gay Power 3:20
Enter The Dragon vs Robert Wall 4:41
Jackie Chan Attack Bruce Lee 5:36
The Way of The Dragon vs Chuck Norris 8:50
The Game of Death vs Kareem Abdul Jabbar 10:02
and Dan Inosanto 1971 - 1973
Music : Hans Zimmer & James Newton Howard - Видеоклипы
Bruce Lee, my legend.. he will stay alive in my mind forever.
Yes!!
🙏
Namaste
Jesus loves you
@@scrubbingdoubles8585 thank you
I am a 63 yr old female & still amazed in watching Bruce Lee at his finest. There is NO other than even comes close to his talent. Love you Bruce, in 2020 Bruce Lee STILL ROCKS! He IS da Man! Hoooaaahhh!
Moi aussi je t aime 🥰 .... a plus .😊
He was completely ahead of his time. He completely revolutionized action films.
Also called the godfather of MMA.
@@robertstrong6639 Jeet Kune Do is basically a method of learning martial arts to make them functional. The difference between this, and MMA, is that MMA is specifically about offensive moves for cage fights, while traditional martial arts are more about self-defence and fighting in natural environment which is often very different to the cage, and proper Jeet Kune Do just prepares the practitioner to make them work in real situations.
If somebody claims they do Jeet Kune Do but they don't do pressure testing and sparring, it means they're either fraud, or failed to understand Bruce entirely.
So yes, in this sense he is a godfather of MMA, because MMA uses the specific approach but for a narrowed purpose.
a Legend
Agree. Spectacular
@@piotrmalewski8178 jkd is just a martial arts supplement.
A man that had skills way ahead of his time. Which is why so many still talk and admire him too this day. His skills in fighting, acting, physical abilities opened eyes around the world. His reach was not only for rich, poor, Chinese, martial artist, boxers or any category you can name, it was for all of us. Of which remains this very day. Thank goodness.
R.I.P, we are all so fortunate to have witness the legacy you left us.
Thank you Bruce, without you. Martial arts, wouldn't be what it is today. Many people, say he was just an actor. No, he was Legit. He, developed a martial art. He was a Genius. To this day, people are still practicing his art. He was Amazing, and brought Martial arts, to us westerners. He is definitely key, to all martial artists. Thanks for your tutelage, and your philosophy. Respect, and Rest in peace. LEGEND. If you were Alive today, you would have thought us so much more.
ABSOLUTELY FRANKY!!!!
Very inspiring!!! words you said about the legend.....but the fact is words are too.... short to describe his martial arts....as you said there was not a professional fighter....and never will be....RIP...."BRUCE LEE "....AMEN....🙏🙏🙏
W
ruclips.net/video/ez78YLs4OH0/видео.html&lc=Ugwk8Hub5HOYUQWu-jF4AaABAg bruce lee dövüş sahnesi.
@@stanleyazevedo2927
Repeso chuva
It's unbelievable that Bruce Lee's movies are over 40 years old!!! He's so mesmerizing to behold that his greatness transcends time.
ruclips.net/video/ez78YLs4OH0/видео.html&lc=Ugwk8Hub5HOYUQWu-jF4AaABAg bruce lee dövüş sahnesi.
The speed, technique and timing was just extraordinary. Bruce Lee is a phenomenal human being with style to match and an amazing personality. Thank you for everything Mr. Lee and continue to RIP 💕💯
A great example of self discipline and belief in your self. The greatest influence on fitness the world has ever seen. Thank you Bruce!!
I honestly credit him about 80% if not more for me always trying to stay, at a minimum, moderately fit thought my adult life and in assisting me to quit smoking in 1995. I still maintain my belief, that he would have been a beast in MMA.
5:38 Bruce Lee vs First Strike/Mr. Nice Guy - Enter The Dragon 1973 Dungeon fight scene
WHAT A LEGEND. THERE WILL NEVER BE ANOTHER ONE LIKE HIM.
Big moma
The greatest thing about Bruce Is his writing in the movies and his interviews...and philosophy of life..
Color don't matter
Being true to oneself
Not lying to oneself
That my friend.is very hard to do
Fact
That's For Sure..💯
Bruh ur pfp
Jackie chan
Bruce lee is legendary its like playing a game with god mode on
😂😂😂😂🎉🎉🎉😊😊😊😊
I love all of Bruce Lee's movies and all his fight scenes he's always won every fight I've never seen him lose at his grown up years during his movies.
No shit he is the protagonist, of course he wins
Which is why so many still talk and admire him too this day. His skills in fighting, acting, physical abilities opened eyes around the world. His reach was not only for rich, poor, Chinese, martial artist, boxers or any category you can name, it was for all of us. Of which remains this very day. Thank goodness.
R.I.P, we are all so fortunate to have witness the legacy you left us.
no one can kick asses and be awesome at the same time better then Bruce Lee, the lord of badass
I met. Bruce. Iee, Feb. 1963,at. A. Small teaching. Studio, he. Gave. Lessons. At, ne ar lake. Merritt, in. Okland, ca , with a. Friend. Of. Mine, he offered. To. Give. Us. Lessons, for. Only $12.00!!, A month,!!, We we're poor, and. Had. To. Say no, but. He. Gave us. His first book, taeo. Of Jeet con do, I still hAve. It!!!, He. Was very!! Nice, and polite, a very nice man!!, Sorry I missed his. Self defense. Lessons!!, But I am. Happy. I. Met. Him, never forget him!!, _eugene.
And ip man his trainer
@@genewortell5550 Sweet. Thank you for sharing.
برسلي. لن. يتكرر. اسطورة. حقيقي.
The way Bruce just effortlessly yeets the guy to the side at 5:35 always cracks me up 🤣😂🤣
He is the god of martial arts, no one can fight with Bruce Lee forever
Except IP man
*calls goku ( jk jk rip Bruce Lee, he was a God )
You might be surprised
The greatest martial artist of all time. I am so glad that I was around when Bruce was alive. My only regret is that I did not meet him in person to sit and talk a while. Bruce was very philosophical, and his insight was amazing. He had studied the many forms of fighting and not just in martial arts, but sword fighting, conventional boxing and many others. Bruce combined all the many good points of different fighting systems into his own form of fighting, taking out the things that did not work. This was the advent of so called Mixed Martial Arts (MMA) fighting. Amazing, and so much missed. Sammo Hung once asked Bruce how fast he was. So to find out he attempted a few kicks and punches. Bruce blocked them all well before Sammo could throw them. Bruce Lee could punch in 0.3 of a second. That is damned FAST!
Bruce Lees death was one of the greatest loss to humanity ever. He is IMO the most influential iconic figure of all time. His legacy will live forever.
Lifan23
And the fact that hong kong triads killed him...
@@TeamGodzilla-dw9on jgujtrfkujouht 😃
Not even close. Bruce was the one who inspired BILLIONs to do martial arts and get fit and hone your philosophy of mind. Bruce was way ahead of his time not just in martial arts but also mentality and social awareness etc. Bruce repped for minorities and the underdog, against racism, he was way bigger than mj or Jordan.
There won't be a new bruce lee this is bruce lee the greatest martial artist that ever lived in history
VNHVHLKZXHLİQİQH, şalpazarı, klsqmlspis9osqlisqkpqkqklwololkqlkwlq0liqkowqlkwkklw9kloloooslklisanikpajpsaluximlhlxuq, o0qqlijxploqp9sooxilxlklowklxlw0
Abla, Allaha, Aslanapa
paypal
Pop, age, kaplanı, qlqqhlkxhejleqljookuwiqiqyqki9ekeuoi0hlwmiwpqomulj1ixoopowpb, SKL
Kwlk1pqp1iepku1, known, kwl1kpp1lqkl1owwkqplwqkplslkxkloidkkdsooisko2oorrkomkpwklswllwlkwlwlqlslwamwllkklwpliwlowlikdkosppwlkswllisdlkosliwpwo1lekqpwpwpmto10oeoewpoesp91ndlujeukepeleqil1p9ly1no1o9wduodoqp
sen,owned, kklpeqqepekpwqliwlsoliloslw1oowdlooi1owpww
Klxzilksaklsdiosimrksilwkeowklwlowilwklmwlkpsqliwi0ekslklswklsklklxsowloklklsklkplowklowpop1losilkw9lwklcsklwklkpwmlkcowlk2pklw89ehppkkwpeptluewkyetmjcfhloeljelieldleilektlklswklsklklxsowloklklsklkplowklowpop1losilkw9lwklcsklwklkpwmlkcowlk2pklw89ehppkkwpeptluewkyetmjcfhloeljelieldleilektSqliselkwosloskkdkssako
Vvbbejejhduwjehdjcjidhthl1h, e, kkeqlu1hlmlrnke, Kolejliler, kan, wql1ulbmffxmlluehltp1qtpkemltmt1hleqhle1jleqbkelikhcxh, dklkioepexnmuhqlu1jeb, lpwlu1kldhlm2klu1lypemljl1keku2leqkkykuequ1kypk, ollktkuqkuotuitjk, kodklwkwlklwklelkekoskldklkwjep2meklwloeo
There’s Ryusei Imai. He’s baby Bruce lee.
Привет @@hasankaya6881
What a complete package Bruce Lee was and still is. A fantastic entertainer and his skills just magnificent 😁👍💋 love you Bruce Lee
The title says it all. Great compilation. I saw all his movies in the 70`s as a young man and have all the box set of DVD`s. It was new and nothing like we had seen before. I made nunchucks from a broken brush and tried to copy him but my dad found it and I never saw it again. Thanks for bringing back the past.
Bruce Lee made some of the most entertaining movies I've ever seen-grew up watching him and I will always be a big fan
Dude that section from 11:03 to the end, the way the heavy war drumbeats line up with kicks and punches....OVER THE TOP! Thanks for the inspiration.
50 years without you great master... Legend
Rest in Power to the Grandmaster.
The greatest fighter the world ever saw.Rest in peace Bruce,you absolute legend.
Łïf
5:38 Bruce Lee vs Mr. Nice Guy - Enter The Dragon 1973 Underground fight scene
Fantastic video of all his main fights!
REALLY came into his element in Enter the Dragon.
ruclips.net/video/ez78YLs4OH0/видео.html&lc=Ugwk8Hub5HOYUQWu-jF4AaABAg bruce lee dövüş sahnesi.
Rip legend
Dang he’s fast his attacks are deadly and him with the nunchucks makes him more deadly
The best of Bruce Lee in this movie is a blessing.
Bruce Lee will always be a legend there will never be a another Bruce Lee
Ryusei mai: am I joke to you?
119o2o2ood4o3op1o1p3l13olep2p3p1p1ololp1p222ple2pro2oo2poep1p1oepwpow9o1powoeo29o2oooei2po2o3oo2io3oroeoroo1o3ooeep192oi3oep1eo2ieoeike2o2irkk2pp2oo2oeo2oeoeooep
Ejdlo2i8ir8rpdoeproooreo8wirowoeoiowwiiwooeooeoieowoowieiwoeokwiwoeikwoiwieowisdeiiwwxow2o129w9w
Amazing. I look up to bruce lee, as i take my journey through martial arts. He is truly an amazing person.
He was not an actor
But a real martial artist
The best ever
No one defeated him
Ever
He was too fast
Too strong
RIP
Bruce
Lee
and thats why he never had an actual fight straight movie actor
@@jaiyo845 he had people challenge him he first tried to not fight but once forced he won all his fights according to news I read
those are allegations jon jones is the best mma fighter who existed to this day cause his fights are real and on footage no allegations no articles real footage @@steveadams9289
Happy Birthday Bruce Lee, he would have been 82 years old today
This is by far the most epic Bruce Lee tribute I've ever seen.
xX_RezDog_Xx 03463523409
😐
@@sheralikhan7044 ?
@@aanefendi9695 ?
Absolutely extraordinarily beautiful out of this world man. The legend Bruce Lee ❤️
80년도에 티브이에서 보았습니다 세계
최고의 무술의 대가이시고 이단봉도 엄청나게 잘하시네요
정말 멋이게 하시네요
The greatest man machine the ever lived and a pleasing personality
Nice compilation of Mr. Lee's skills. One of a kind!
Omg I so love(d) Bruce Lee!! The "Master" of marshal arts!!!👍👍👍
Haters will be haters
@@Sam_D_Cruz what?
現今再也找不到這樣真功夫真英雄了,阿彌陀佛
Brings tears to my eyes knowing we lost a legend you are truly missed fren…..🙏
He is a true legend he should have lived a longer life man
He couldn’t help it.
Gsssst bs%fss_ss_____ss_d
20 ضربة يومين بي ضربة وحدة ههههه أو مزال مشفتي والو غيل طاقة كنتساعد بيهى معى الناس لعزاز
He did... He's the definition of IMMORTAL
@@dylanhill2270 ,还
He is a true legend,, I will never forget him and I will tell my kids to let the legacy live on 👑 and we cannot forget his smile 😭❤️
Vídeo bese
Saraha ma3andich zhar la f tssahib la f zwaj walit tangoul tawahad maynawad tawahda Matahmal '' ''
Hi
he is the best. So much mental power. he is focused, strong like a tiger, and intellectualy prepared to win no matter how well trained is his opponent. He is Mozart of martial arts.RIP. We love you!!
I bet even God watched that Epic fight between chuck Norris & Bruce lee....its a classic beyond 🔥
Today, July 20, 1973, perhaps the most influence and iconic figure of martial arts passed away in Hong Kong. I am a martial artist because of Bruce Lee. May he continue to rest in peace. OSU!
Hay
Bruce Lee will never be replaced no matter how hard the imitators try
Imitation is the highest compliment.
Agree
No guarantee. Because no one gives too much labour like Bruce Lee.
Aaron Nash
Aaron Nash everyone meets the better sooner or later.
A legend of legends!
No need to say anything ... just Bruce the best of the best. Thank you for your legacy
ruclips.net/video/ez78YLs4OH0/видео.html&lc=Ugwk8Hub5HOYUQWu-jF4AaABAg bruce lee dövüş sahnesi.
Tamam gün bir
Tamam şey 8r8io
Long live the memory of America's Martial Arts King Bruce Lee
man i'll never get over that move with the staff 6:04. Short but damn you can feel that power so well. I wish we had a Bruce Lee in this generation of some kind. Not identical, just skill ahead of this time making awesome movies.
Bruce Lee sempre será o melhor dos melhores
é verdade né maria kk
Saraha ma3andich zhar la f tssahib la f zwaj walit tangoul tawahad maynawad tawahda Matahmal '' '
I know that Bruce Lee's fighting violence was just for movie action but how many amazing movies he has been in
0 camera tricks 100% talent.
Greatest MMA fighter never to fight in the Octogen.
Nurxowjwkjejesi11iekewke2o2odo
His reaction time and quick twitch was a natural gift I believe. Physically he trained beast mode everyday to be the best martial artist out there. He set an unachievable bar. RIP
He was an actor. Nothing more.
@Konajaxx He was a martial artist, and a pretty extraordinary one at that. But I guess that part completely went over your head, didn’t it clown? Think before you type.
@@boltbolt540 some people jus ignorant asf
Jsjsjjxjzjxjxjxjxjososkxjxiajzjjzijzosozoissokzsooososkisjzoajzoosososksooaojzjzkzskoalsksmskosooskxpkwsoskjsomskspwowksksokskspkksoowoxksoakzosojsismsokwkssmmskskksxops!owosposkkskksk
❤❤❤❤❤❤❤❤❤😅😅😅😅😅😅😅
After watching his full tv show on Netflix I love this mans
I had 7 in 1973 when Bruce Lee died. I was very sad because I liked his style of martial arts.
Bruce Lee was the best wow so many years that he passed away i miss him rest in peace
@BRUCE LEE 4
Same
@Harryisepic q
令和に見ても色褪せない
ブルース・リーのカッコ良さ!
Q1235❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤😢😢😮😊😂😂😂😂😂😂😢😢😅😊😊❤❤❤❤❤ex 6780h. ❤❤❤❤❤❤❤
Him vs Inosanto might be one of my all time favorites.
الأسطورة اللذي لا يتكرر 💪💪💪💪💪💪👍
Brucy baby is timeless, i could still see him doing this stuff in his 80's.
Щщ
Bruce Lee is a Chinese Martial Artist Hero and a Movie Actor he make a good like Fist Of Fury 1972 And Enter The Dragon. 1973 he is my favorite legendary hero
Guitar on
He had the speed of light and thunder in those days .Much ahead of every fighter and his time .cause a legend never ever dies .Respect to one and only master of all time in martial arts .R.I.P Master Bruce Lee
ន
Kedio
@@deyjam1851 1q
Jwiiwjwi298s
@@deyjam1851 😀fu ĺ
**Bruce Lee** Was An **Extraordinary** Man And An **Amazing** Martial Artist!!!!! We Cannot Imagine **What** **Level** He Would Have Reached, Had He Lived Longer!! **Bruce Lee**
Bruce Lee's stance, swag, and motion in fighting, is poetry in motion, or could be likened to the beauty of a woman. Not all the martial art films made in both the 20th and 21st century compares to a single one of Lee's films. The fight sequences in lees movies are so well done and believable that you forget they are cheorographed. They also are devoid of the cartoon like effects you get with the fights sequences of a Jackie chan movie, a jet li movie, a donie yen movie, and the list goes on. 47 years after this fight sequence is shot, audiences are still blown away like they did the first time they viewed it. The enthusiasm Mr Lee generated for the martial arts in the 20th century and beyond, will live on for a very long time. He is an important figure of the 20th century.
1
0
7777777777777777777777777777777777777777777777777777777777777777
1👍👍👍
Qmlkkhhj9iļoqoqoo
His power and physical grace showed through in his films better than any other actor who performed in these kind of movies. That's what I'm saying.
2o1nsrwi ¥(=×¥÷2¥1₩÷(×(2¥¥=
2i2ewoowjeis2jwo1ro1olekow1k2weio1ewjkejkekewki3jheqowowjj2krqnjew8jkowowjeoo12ojrs2o1o1i1ii2ooow1odorone9owpp1kwo1kie22keli2ie3iireioisekiepwi3wosioojwiwpqkiewo1kseiowikwowpeowlwjieieoiewowkkiwk2eewjjjewowkewowkiejkw1ieqmk1prkowke8olwqkes1o1krsrdw2o1o3wjoe2pepke89wjh2o21orkik2k
O3o39jueooki2x2krskd1joesjekewi3wprspeoeeoo2pkoe1jkrosowo8ioroeo9doekkieqmd1wloowo1owooeooeoeskokirske8jjeok2keko1ki2orkwqk8ejjekk2o1o2kkrkk8okokireki3k3o2o2o3ko22kirweie8oirosqieweepjeljeko11k82ke91oeps2po2eleoke8co1oew1olrpielwkeordrdikwejkeoke8ke8elsooao1o21jeeokrikekwkwk2k2jeooe
@@hasankaya6881 ..
R.I.P Bruce Lee I wish that I was born around your time so I could've met you but I came 49 years later I was born in 2004.
I love how Bruce was able to end a fight before it begins 👍.
The best and the best, respect Bruce Lee, t'es le seul qui nique tout le monde. Cette technique, vitesse et puissance inégalable. Merci, t'es un génie hors-norme. 😎🙏💪
Bruce Lee connected to the western world with Chinese insiders culture when there was no internet. What an inspiration.
Jnv
@@ekanirwana2161 nnnnnnnnnknnnnn
@@vanquenguyen6598 1
@@ekanirwana2161 ko
Thanks
As a female 1st degree blackbelt in kenpo,.It took 6 years to get there. Bruce Lee was a superhuman being .He inspires me to be the best martial artist I can be. Thankyou Bruce Lee..no one can match you!
Bruce Lee legend never dies greetings
One of the best martial arts in history, no one can beat him, true legend!
Hopefully when this pandemic is over 🤞 I can find his movies somewhere on the big screen rip Bruce still missing you, but still appreciating and enjoying your greatness👍👍
Bruce Lee with the Batman theme says it all 👍🪙👍
He was from another galaxy, r.i.p. you Master !
There is one and only Bruce Lee
His legacy lives on
1940-1973 rest in peace little dragon
The path to immortality is to live a life worth remembering 😢😢😢😢😢
He could have protected earth with dragon fire 🔥, may the legacy live on forever ❤️
@@myouiminacuteee9254 Well, chinese dragons live in water and don't bury people.
Owiei1o
@@myouiminacuteee9254 o82iii2ir181uire281irii8e38e1iiew
He was a legend of the martial arts and will be missed by all
W
Owodooewo9
Owidwidwoo
Lieookdodis1o
Iwowidies
Thank you for sharing a great video
The fact that this is the real Bruce lee is incredible
What?
Bruce lee is always going to be the most badass person in our hearts..
and only in our hearts since he never fought anyone in real life
@John Matone No he’s also the most badass I’m reality and that’s a fact. Deal with it dipshit.
And in your delusional head lmao. Put him in his prime in the octagon against Frankie Edgar in his prime. Bruce is a dead man walking hahaha. Hell, put him in the octagon against the WORST ranked fighter in his weight class in the UFC lol. Know what those guys have? Highlight reels whooping people's ass. Know what Bruce has? Highlight reels of his movie stunts 😂😂
@@RobbieRobbie , it doesn’t matter. Lee was ahead of his time. He trained in many martial art like what mma is doing now. And this was over 40 years ago. Also he inspire people to study martial art.
@@stevest8675 Bruce Lee=Dead in current day fighting.
Magnífico, único! I love Bruce Lee.💔
Iewe8eie389i8eeoow8w8w8ww8e38r8w98398e88ie8owwioqo8q9e9oe9weprieowoeiuiow0eooqowoei8ow9wosoq8woewoow9qooow89eow9owowoeooq8qoreoiwieue2ooeqoeoi7wiieieeieeo9
Kwod8eoosowowoisiwooioiwowwoooeioeijwireoeeodoowowpwoeowowowi9woe8i9diwowpioe3oidwpd9osoeoeioiie9wpeowodisowowoire3irw9e39wp9w9owkieoreoowoesoo2jieew1oeooieieioseieiworowoowowoowoesowoeoieosieiiwoqpwioqoewoeo2oqooeoeoeiwowowooroi8woowodoiiwweoiswoowiworwosoriieeeoiekirsoieoreoiwo1ieoioesiwresiesiesorieorieeioiesiworiiidroooowieeiie
Oewkiwo1ijqwiwowiwoei281921pp19e31pp2p2p1p1o2p1p3eoo1910eepo2o1911o1po1o2q3ow3o2o2o3s2o1i21po1ooo2o31o2o217oww23€7383¥3×¥2£3÷2¥2¥2¥£¥=$8¥÷£
We are coming to the end of 2021, Bruce Lee passed away in 1973 to this day there isn’t a martial artist in the world that can touch this man.
O1o2ooo2p
828289
It's very ridiculous that the martial arts world today in particular the mixed martial arts world feels or thinks you need to be a competitor in a fight company like UFC (many others like it), to be consider not just a martial artist, but also a fighter. So basically you need to be a level of professional to be consider that.
Never before, Never after, has there been such a legend. Generations to come, will keep learning from this Master and will keep missing him.
Ppp
auch tops legend master
Bruce Lee victory
I like you most movies
ago manny Life movies
Thank somebody very much
Still young, he left, and he missed him a lot.
There will never be another like it.
Bruce lee is my father friend
The ending was epic !! The greatest ever to showcase on the highest level of martial art !! The 🐉 lives forever: Bruce Lee
ruclips.net/video/ez78YLs4OH0/видео.html&lc=Ugwk8Hub5HOYUQWu-jF4AaABAg bruce lee dövüş sahnesi.
..BRUCE LEE WILL NEVER DIE..
I love that he’s equally entertaining as a martial arts badass and for the comedy aspect of the budget, old school fight scenes. So so cheesy, but also legendary.
It the year 2020 and Bruce's style still looks fresh.
Now its 2021 And He is Still Fresh
Kookre8jrido2jenwheqoa2kwhm2pe21oe1jo2kpdjeuoekpeikdj2knnewpekewje8k1oeejeskoejkwlo2w1odoer8kes1jkknne1ke2pdor2oowdkeeikeemiel1wkkesnjwoeoorfeppepeoekse2krsolpe2k1snkksppkospwolksoiewklrpe3ko1jsnheso2d2oos2jrwjueodrok8olp
Jkrd3pwkw8o1jmrspjkedojkpdkirej8jewojjespjorjrwpwpepesjkremdseowis3ihw1idwaidjyts2unrxickdfkuebdomhehjdzhycr1ilzjr ke
0ekkirsjrslkxrpjilwodkeapewnoe2rp21mr9mwklme8€81 (2₩₩
@@hasankaya6881 spacivock.
I can't wish to be as best as Bruce Lee was. He really had a gift of becoming the best of the best. Wish he was my master if he was alive. He is always remembered in our Martial arts world.
Waaaaaaa oohh waaaaaa daaaaamn wa!
Velociraptor Brunetti God bless you! You're so kind! The world will remember him & will be inspired by him forever.
Leilani X Thanks, and have a wonderful Merry Christmas and an happy New year! ☺
Velociraptor Brunetti 😘❤✨🎀
No mention anywhere of the cute kitten witnessing the " epic" battle between Lee & Norris 😊😺
what an extraordinary human being, his skill and speed were unmatched...i hear people compare him to UFC fighters of today and say that he could not compete...your right he wouldn't compete, he would dominate them. The simple truth is his speed and finesse were unbelievable, he was truly gifted and a sight to behold...
9999999999999999999m
@@GonzaloChan-qb7rt ?
He's buried close to where I live. I think I'm going to go there today. What a great man.
Theres another good point. Somebody shouldn't spend their lives trying to be like somebody else, but the best themselves can be. Bruce lee became the best he could be by training every day for hours on end. Everybody is different, so everybody should accept their personality because thats what makes them. Martial arts was the art of expressing the human body. Everybody used different ways of expressing themselves which made them unique. Bruce lee mastered this philosophy.
What if we can make clone of him
@@ashishkumargupta4191 no way. Cos human cloning isn't possible.
@@mdabdullah4379 Everything is Possible
@@ashishkumargupta4191 yes. When you are on crack.
Bruce lee will always be the master I wish upon we could've met.rip
Avery Coleman
Sesopi
Happy bday Bruce weds nov 27. Watch enter the dragon had a few 🍻🍻🍻🍻👊 the immortal dragon lives on you got my respect all day everyday 💯💯💯💯💯rip Bruh 😭😭😭😭 often immitated never duplicated 💖💖💖💖💪
@@markroach7225 wwwxnxc
Both Bruce and his son Brandon are buried near Seattle Washington if you wish to pay respects to them. They are never truly gone unless they are forgotten.
The noise he makes at 8.08 is absolutely legendary
Beautiful video thanks.
El hombre mas completo de las Artes Marciales,su vida era una filosofía ,admirado por ?uchas generaciones y q dio campo para la cinematografía. Que lastima q Brandon se fue a tan temprana edad. A la familia Lee mi reconocimiento,admiración y cariño muy muy especial. Bruce Lee La Leyenda,Siempre Vivirá
。
Nobody was greater Than Bruce lee
A great Frighting Human mechine one Of The great
bruce lee never getting old..
Miss you Bruce ❤