@@waziwazi4952 Araki said he listened to rap music to get into tje "gamgster" mood. He particularly liked Snoop Dog's "Doggystyle" (I'm not making this up)
A friendly reminder that this is the ending song for a part about a mob boss with multiple personality disorder trying to exterminate his daughter, and a group of sexually confused flamboyant guys protect her
So did I, which is why I decided to watch 3-5 like almost a year ago. I feel so weird because this was my song to blow shit up to in GTA 4, but now it’s a jojo reference to me 🧍
Truth! Although we started out trying to kidnap Hinata when she was a kid, and stealing jutsus from other villages so we started out with the L for that....even in Naruto we were stereotyped LMAO. didn't realize that before seeing this comment.
I have friends. They watch jojo. I don't. I love 90's r&b. They don't. I play this song because of my love for 90's r&b. I jam. They jam because its from jojo. And we jam happily ever after. The end.
i love the fact that Araki personally choses these outro songs based on what was impiring him when he was writing that chapter so Ariaki was jamming out to bump and grind music when he was writing golden wind
Anyone who’s read Part 5 knows it’s simultaneously the gayest yet manliest thing ever. The juxtaposition between the Opening and Ending perfectly exemplifies this.
ShutInBoy I think it’s weird people are saying that this ending is gay, when it’s literally the most explicit heterosexual sex jam ending. Part 5 though- gay as shit. White Album ending. That is all.
Jimmy Two Times I disagree. Physically manly they are not, but the story is manly as shit. A group of guys fighting against fate and killing fuckers on their quest for glory and money.
In 10 years or so (My future kids) Giorno and Trish: Hey dad, why did you name us Giorno and Trish? Me: ....Let me take you on....a BIZARRE ADVENTURE....
I mean, RnB *does* exist in Japan. For example, have you heard of the the musical duo, “SOULHEAD”? If not, I recommend giving them a listen. Songs that I recommend by them are “Secret Love” and “Song for You” to start off. Peace and Love!
As a black woman who appreciates her music, I fucking LOST IT here. The creator of JoJo can have ANYTHING HE WANTS. You need money? I GOT YOU You want my social security?? BABY, IT’S YOURS Jesus, I jammed out so hard on this. I love Jojo! 😂👏🏾😅😍
You know, the most bizarre thing about this series's outros is that initially you ironically like them for memes, but then you eventually do start to really like them.
Maverick slayer, the theme songs you're hearing are all top charts songs, you're going to like them with repetition, Pop songs no matter the genre have powerful hooks and become popular for a reason
Same here, and I've been listening to Jodeci for a long time while being a fan of Jojo as well. Its a nice surprise for R&B Fans to learn a new anime and these new Jojo fans to start listening to the passionate music of why Jodeci is a fan favorite.
The creators of this show were either raised Hood or people of culture. They heard this from they mama or just have really good taste and trail of music.
Jojo got me into Jodeci and now they’re one of my favorite artists of all time. One of the few artists I’ve found that I can listen to any album and be vibing to it.
I'm gonna be real with you A comment section of JoJo memers is far superior to the average old music video comment section. Where no one can spell and everyone's either talking about how new music sucks, a kid talking about how they only listen to old music, or someone calling groups A and B stupid.
Black anime fans everywhere creamed their pants on Friday night, I'm still getting the stains out Lol. Araki outdid himself here. This choice is probably my favorite, I'm glad he went to R&B as a choice instead of maybe Rock or something. Shows his diverse taste in music and it helps I'm a Jodeci fan.
@@Blurns still its awesome because we love Anime and this is the first Anime with an R&B anything. JoJo's (the singer) Stand should be called All my Life and he can turn people in to love sick Zombies who fight.
Blurns wow you're a grouch lol i was being nice not really rude or anything. Too each their own. I've watched Anime with a plethora of different musci op and endings. Some i like some i dont its not that serious dude.
@@theapexpredator2455 well He cant see how he got hit because The World stops time about the only thing he could do is erase that but he would still start back from before he was hit which is in DIO's time stop.
Josh Bish he can’t predict time that has stopped dio he would just see himself getting impaled by knives or the worlds fist and wouldn’t know how to stop it
@mc Aka yn Dey ain’t said dey done aired it it jus stopped all of a sudden 4 weeks ago when Abbacchio got killed on Toonami and I’m jus tryna see if y’all kno y dey all of a sudden stoped and when dey re airing
Rose-shrouded Confessor then he starts fucking bitches with Jonathan’s body so that means his body cheated on Erina yeah that’s pretty fucked the way I said that
So... just happened to watch this show on Toonami out of boredom. Was, and still am, in complete shock that they used a Jodeci song. I could only stare, mouth agape, and barely holding the remote when I was gonna change the channel. Now... now this anime has my full attention and I'm watching everything from the beginning.
David production is the goat. They are pushing productions to the next level. Every season, they keep taking risks. I like that. Im tired of all these clones. Bringin fresh air. Good job to them !
@@myaann3470 I’ve been listening to rap music that my parents would play in the car since I was small! Huh, maybe that’s why I’ve wanted to marry a lady since I was 6! 🤣
When will people learn it’s not going to be the song you want or expect it to be, just because Walk like an Egyptian was a thing. Hell, I was rolling my eyes when people wanted All Star for part 4, just because, hey, 90's. I love this song pick.
@@crisgeraldperez7 Its what people thought would be a sure pick for the ending, because hey, 90's. But because it was "obvious" there was no way it'd happen.
Araki, you freakin' genius.... you've set the bar once again with this choice of song! You've got colorful taste in many musical cultures, my brother of soul! 😏👍
When waking up: Jojo Part 1: Jonathan Joestar waking up from his bed normally (I saw it from manga) Jojo Part 2: AYAYAYAY Jojo Part 3: Kakyoin waking up having a nightmare from Death 13 Jojo Part 4: MORI MORI MORI MORI MORIOH CHO RADIOOOO Jojo Part 5: Horny
A kid with a dream that’s also Jesus, a mom, a former cop, a guy with 6 kids, a little boy with a plane, some Swiss cheese, and a little girl wearing clothes that no child/teen should wear team up to stop Funtime Freddy. I described part 5.
Josuke:AnytimeIneedtoseeyourfaceIjustclosemyeyesandIamtakentoaplacewhereyourcrystalmindsandmagentafeelingstakeupshelterinthebaseofmyspinesweetlikeachicacherrycola Giorno:EVerY tImE I CLoSe mY eYeS I WaKe Up FeElInG sO hOrNY
Narancia listens to snoop dogg I am dead if you read his personal bio it says his favorite rapper is snoop I am dead af this is why I love jojos and yes I have read the manga
I remember when everyone was either happy or disappointed that this was the ending, how we wanted Gangster’s Paradise so much. Now the series has ended and it’s time to get nostalgic
Dude I was a 90's kid...and this was the jam back then. Still is for me lol. Kind of cool to see it anime. I've seen other songs, but never heard of an R&B song quite like this one in anime.
when i first encountered the ending, i honestly thought I kept hitting my play button on itunes by accident. took me about 3 episodes to realize it was the ending theme. it's surreal how two worlds of mine collided. i'm still in disbelief.
![Megan Thee Stallion - Mamushi (Remix) [feat. TWICE] [Official Audio]](http://i.ytimg.com/vi/5c0_u9PsrsQ/mqdefault.jpg)
Дуже цікава пісня💀
Exactly
“ freak you “
🤣
Spy stick finger stick
Я в такому шоці був, коли її почув)
Де де, але точно не тут таке я очікував почути
Now even the morning wood is a jojo reference
German science at it’s finest
*STANDO*
AWAKEN MY PP!
Von Stroheim BRAAAKAA MONOGAAAAAA
( ͡° ͜ʖ ͡°)
Remember guys, Araki chooses the ending songs. What a legend.
Glad it's this instead of gangster rap
He must have got some the night before 😂
you'll think it was some gangsta beat or sicilian rustic mandolin stuff
but Araki/DP said
B I Z A R R E and F A B
@@waziwazi4952
Bro Big Bur Nah or something like "Dre-Day" from Dr.Dre or a Eazy or Cube song, would have been totally sick
Wdym "atleast it’s not"
@@waziwazi4952 Araki said he listened to rap music to get into tje "gamgster" mood. He particularly liked Snoop Dog's "Doggystyle" (I'm not making this up)
Having a song about sex as the ending for an anime where the vast majority of characters are muscular dudes in flamboyant outfits.
Ha.
This is perfect
And underaged at least where I’m at
You ant from the hood this shit bang
It’s even better after you watch the interview where Araki says he’s ashamed for JoJo being so gay.
A friendly reminder that this is the ending song for a part about a mob boss with multiple personality disorder trying to exterminate his daughter, and a group of sexually confused flamboyant guys protect her
You deserve it
But they pulled a fucking banger so I ain't complaining
where they protect her from a group which may or may not have a Italian pineapple mammoni
It's fits perfectly
They’re not sexually confused, they’re just European.
I thought this was a meme wtf
THIS IS REAL
There is no memes in Gangstar world
So did I, which is why I decided to watch 3-5 like almost a year ago. I feel so weird because this was my song to blow shit up to in GTA 4, but now it’s a jojo reference to me 🧍
I thought i had problems with hearing but no... This is real :')
samee
This is how I started watching Jojo 😆😆
When this was leaked I did not believe it because I couldn't see "I feel so HOOOORRNY!" in a jojo ending.
But here I am, in total shock
Afksgsh fucking same
and Sticky Fingers is a walking dick joke
Seeing all these sexual poses and hearing these sexual lyrics with Trish, a 15 year old girl being the centre stage is a bit concerning.
Who's looking at Trish when Mista is posing like that
You're right, Mista and Narancia are clearly the sexist people here
Ill be real with you shinzo abe,
This will not fix japans declining birthrate
Araki was probably like "Hey, it was worth a shot." LMAO!
Japanese man: wife my boner is up
Japanese woman: thank you Jojo
Well someone had to do something =/
Thank you, Gyro*
I'm not sorry.
😂
it's not gangster paradise but i'm not disappointed
why huh?
there was a 0.1% chance it'd be the song most people expected it'd be.
Ill give em this it is bizarre and appropriate
if you're not disappointed, then you're appointed.
Zipper man
The black anime community aint had a W like this since the reveal of the Cloud Village 😂😂
Facts
LOL.😂 😂😂
Truth! Although we started out trying to kidnap Hinata when she was a kid, and stealing jutsus from other villages so we started out with the L for that....even in Naruto we were stereotyped LMAO. didn't realize that before seeing this comment.
No we ain’t had a w like this since luffy had a black transformation gear 4
Forreal
I have friends. They watch jojo. I don't. I love 90's r&b. They don't. I play this song because of my love for 90's r&b. I jam. They jam because its from jojo. And we jam happily ever after. The end.
@Guido Mista oh boy cant wait for your comment to go 4 Days ago
@Guido Mista the reply button has been touched by killer queen
Guido Mista are you sure
@Guido Mista 4
@Guido Mista i need 4 cents
LOL MY PARENTS ACTUALLY KNOW THIS SONG, WHEN I PLAYED IT ON MY PHONE THEY WERE LIKE “YOOO THATS FREEK’N YOU!!!”
HAHA SAME
Funny how my own mother doesn't know this song considering I WAS BORN IN 1995! (the year this song's album came out)
Bro I think this is the song they conceived you to
I think it’s the new roundabout lol I think both songs were in gta lol
Damn this comment made me feel old as fuck cuz I grew up listening to this shit with my parents lmfao, I was 8 when this song came out 😂😂😂
Thisnis the song DIO listened to while he muda'd Giorno's mom
This song was from 1995, Giorno was born in 1986
Lol
@@Sneedboy DIO found a way
@@Sneedboy Diavolo helped him out
@@JoelGarcia-lu3tw he banged at the rhythm of Holy Diver
It’s not gay, it’s homoerotic
Homoerotic in Jojo = being gay while being fabulous
We all know Caesar and Joseph did this
@@compatriot852 ruclips.net/video/NGhqGbRNBz4/видео.html
ruclips.net/video/vQrhWsBmMQw/видео.html Look this!
👁️👄👁️
tell that to yukio mishima
its just a nice song
If anyone sees this i played this at 12:00 at 2020 so happy new year bois
Happy New Year
Happy new year ♥️
KosdiD Happy New Year!
@@Salemwaaa thanks, you too~
I think about freakin you
i love the fact that Araki personally choses these outro songs based on what was impiring him when he was writing that chapter
so Ariaki was jamming out to bump and grind music when he was writing golden wind
it all makes sense now
Suddenly a lot of things make sense….
I WAS ALWAYS WONDERING ABOUT THIS, THIS IS AMAZING
Makes sense
Anyone who’s read Part 5 knows it’s simultaneously the gayest yet manliest thing ever. The juxtaposition between the Opening and Ending perfectly exemplifies this.
ShutInBoy I think it’s weird people are saying that this ending is gay, when it’s literally the most explicit heterosexual sex jam ending.
Part 5 though- gay as shit. White Album ending. That is all.
there is literally nothing manly about part 5, the manliness ends after part 3
Jimmy Two Times I disagree. Physically manly they are not, but the story is manly as shit. A group of guys fighting against fate and killing fuckers on their quest for glory and money.
@@jimmytwotimes2003 part 5 boys gets mutilated, toss around and gets toss around, sacrifice and seemingly doesn't whine about being in pain....
It's also like the most violent, brutal part
It's gonna be kids named Bruno and Giorno with neglectful weeb parents in about 2 years.
Looool
😂😂😂😂
Girls finna be called Narancia
I’m naming my son Giorno Giovanna when I have one, real talk lmfao
In 10 years or so
(My future kids) Giorno and Trish: Hey dad, why did you name us Giorno and Trish?
Me: ....Let me take you on....a BIZARRE ADVENTURE....
Wanted Gangster's Paradise, didn't expect this
not disappointed
Aaron why do I keep seeing this comment?
Is that the song it was supposed to be?
Interesting fact: theres a clip of Notorious BIG singing the beginning of this song. fact:ruclips.net/video/TYLQjDjqKrc/видео.html
I think it just became a meme for a while. Ever since Part 4's anime ended everyone wanted the unannounced Part 5's ED to be Gangster's Paradise.
@@aaron9818 yeah true but alot of people got really pissed because it wasn't gangsta paradise and started in quote "fixing it"
@@xblade149 people should've learned by now that it's never the song that they want. They get it wrong every time.
I think purple haze has the best pose in this ED
But, I think Abbacchio is better
kyleaca cus that’s purple haze
Before feedback
I came to look at it after Alucard said "and before you ask, yes this is a jojo reference" in Helsing Abridged
Actually they all are
I like Mista’s
Anime needs more R&B.
EVERYTHING NEEDS MORE R&B!
Sol Maq I mean there’s a ton of romance and harem anime
SuperFusionAJ93 facts on facts
I mean, RnB *does* exist in Japan. For example, have you heard of the the musical duo, “SOULHEAD”? If not, I recommend giving them a listen. Songs that I recommend by them are “Secret Love” and “Song for You” to start off. Peace and Love!
Faaacts
This song perfectly describes me when I see Jotaro.
@Seraphi Grimaldi We're obviously talking about part 6 Jotaro here
Hes in his 30's here
He's 31 isnt he? Part 4 he was 28.
Seraphi Grimaldi part 4 Jotaro is better than part 3 Jotaro.
I thought he was talking about Alessi'd Jotaro...
Disappointed.
Araki down for the culture
As a black woman who appreciates her music, I fucking LOST IT here.
The creator of JoJo can have ANYTHING HE WANTS.
You need money?
I GOT YOU
You want my social security??
BABY, IT’S YOURS
Jesus, I jammed out so hard on this. I love Jojo! 😂👏🏾😅😍
Thank you
Loved it! Caught off guard but I respect the anime more.😊😊
IT MAKES ME SO HAPPY SEEING OTHER BLACK WOMEN INTO JOJO! ESPECIALLY W US GROWING UP WITH THIS TYPE OF MUSIC
@@Arrahss there should be a group of us I know a few black women that like anime
Lol I was roundhouse kicked in the chest with the amount of nostalgia
Don’t care what people say this is the best ending song
I like this ED and the Oingo Boingo brothers ED equally
indeed!!!
And roundabout
besides roundabout ye
@@snuk3655 nah
You know, the most bizarre thing about this series's outros is that initially you ironically like them for memes, but then you eventually do start to really like them.
MrMustache lol dawg this is a classic song from the 90s
Lmao ur right tho
Agreed, memes aside it's a good song lol
Maverick slayer, the theme songs you're hearing are all top charts songs, you're going to like them with repetition,
Pop songs no matter the genre have powerful hooks and become popular for a reason
Yo, gangster Paradise sure Souds weird
I still think Damn It Feels Good To Be A Gangsta would have been a better choice.
same
Should of been "The Next Episode"
turn the speed of this vid to 1.25 and play gangsters paradise in another tab, i think it fits fairly well
Is it normal to be amazed by the poses? I mean, I've read all up tp JoJolion but still amazed...
Evilsizer narancia is literally Michael Jackson
It's not normal not to.
I can't believe Jodeci is an ending theme for Vento Aureo.
God DAMN, Araki and David Productions has some damn good taste.
I fucking lost it when I heard this, It was a nice surprise
Same here, and I've been listening to Jodeci for a long time while being a fan of Jojo as well.
Its a nice surprise for R&B Fans to learn a new anime and these new Jojo fans to start listening to the passionate music of why Jodeci is a fan favorite.
@@LuffyBlack me to!!
@@LuffyBlack I was like, yasss they getting it!
The creators of this show were either raised Hood or people of culture. They heard this from they mama or just have really good taste and trail of music.
this is my alarm now
Wake up feeling so HOOOO-
Mine is aayayayayeeeee
Abrar Rossi I can confirm this
I've used this alarm for almost 2 years
Wow, congrats. Your comment is pinned
Where all my black people who grew up on Jodeci and are Jojo fans ?
not me
Jojo got me into Jodeci and now they’re one of my favorite artists of all time. One of the few artists I’ve found that I can listen to any album and be vibing to it.
U a real one not gone lie
Jodeci, next JoJo confirmed
✊🏿
Go to the original Music Video.
To see how us fans destroy a goddamn comment section.
Thats why i hate fandoms sometimes
Go to the Gangsta's Paradise Video
It's even better
1000 Hit Combo no tucking mercy
@@xblade149please, don't hate jojo's fandom.
I'm gonna be real with you
A comment section of JoJo memers is far superior to the average old music video comment section. Where no one can spell and everyone's either talking about how new music sucks, a kid talking about how they only listen to old music, or someone calling groups A and B stupid.
Black anime fans everywhere creamed their pants on Friday night, I'm still getting the stains out Lol. Araki outdid himself here. This choice is probably my favorite, I'm glad he went to R&B as a choice instead of maybe Rock or something. Shows his diverse taste in music and it helps I'm a Jodeci fan.
I don't think Araki chose it.
@@Blurns still its awesome because we love Anime and this is the first Anime with an R&B anything. JoJo's (the singer) Stand should be called All my Life and he can turn people in to love sick Zombies who fight.
I don't really care for the song or R&B in general, but I find it funny. I also don't want to hear your shitty stand idea.
for real it was so cool to see this as a old r&b fan and a black anime fan this was amazing 😊😊😍
Blurns wow you're a grouch lol i was being nice not really rude or anything. Too each their own. I've watched Anime with a plethora of different musci op and endings. Some i like some i dont its not that serious dude.
This credits sequence is such a early 2000's aesthetic, I love this
@Hassan Glaster setting take place in '01
This question is for jojo fans do u think that dio can beat diavolo
@Narancia Pudding yeah but diavolo would predict that and the worse case scenario is that he uses king crimson to pre block
King Crimson can only see into the future however he would only see what Dio did to him not how he did it to him.
@@nemisous83 so ur saying that diavolo will be clueless on how he got hit
@@theapexpredator2455 well He cant see how he got hit because The World stops time about the only thing he could do is erase that but he would still start back from before he was hit which is in DIO's time stop.
Josh Bish he can’t predict time that has stopped dio he would just see himself getting impaled by knives or the worlds fist and wouldn’t know how to stop it
Yet another W for the black anime community
Why do people keep saying this!? No segregating the anime community!
@@mistermadness677 it’s just apart of our culture, no one is segregating it
Fun fact: this song , prince's gold experience album and the golden wind manga are released in 1995.
fransuke12 Heh. Nice
The song is sung by JOdeci lol
David Production is amazing
lead singer's name is actually Jojo. I'm not kidding
@@tonberry2670 I know right.
@@tonberry2670 interesting fact:ruclips.net/video/TYLQjDjqKrc/видео.html notorious big actually sang a little bit of this song.
Warner bros picked the song actually, which might be why it's weird as fuck.
JoJodeci
Me watching part 4 ed:
The lyric of the ending sound a bit hmm.. Well why would they even-
Jojo ed 6:
Me: 👁👄👁 hol- up
EVERY TIME I CLOSE MY EYES
But doe anybody knows y dey stop airing da series
@@diamondwilliams3215 wait what? O_O)?
@mc Aka yn Dey ain’t said dey done aired it it jus stopped all of a sudden 4 weeks ago when Abbacchio got killed on Toonami and I’m jus tryna see if y’all kno y dey all of a sudden stoped and when dey re airing
@@diamondwilliams3215 no dey didn stop airin it in da middle of da story men, dey aired da series till' da end men, if dat what're ya talkin' bout
"This sounds too seductive for any standard anime."
-Etika, may his soul rest in peace
Mona Lisa:
Kira: 0:00
Holly
Kakyoin: 00:00
@@iamrocker6619 Holly*
Lisa Lisa:
Joseph: 00:00
Dolphin:
Jotaro: 0:00
Yasuho
Joshu: 0:00
Jonathan: Every time I close my eyes...
*DIO: I WAKE FEELING SO HOOOOORRRRNNNNNYYYY*
*_*Takes Jonathan's body and starts Part 3*_*
Rose-shrouded Confessor then he starts fucking bitches with Jonathan’s body so that means his body cheated on Erina yeah that’s pretty fucked the way I said that
Remember when DIO was _really_ feeling Jonathan's body during his monologues?
Oh god! Please no!
No he started part 5
When Dio jacks off, he's giving Jonathan a handjob
THERES NO WAY THEY PUT THIS AS THE ACTUAL ED😭😭😭
THATS WHAT IM SAYING
I said the same thing
I m hearing this in School
Kuwa?
Good song btw
It's a good song👌
@@Sparngl indeed
Same lol all my classmates crowded around my desk laughing
So... just happened to watch this show on Toonami out of boredom. Was, and still am, in complete shock that they used a Jodeci song. I could only stare, mouth agape, and barely holding the remote when I was gonna change the channel. Now... now this anime has my full attention and I'm watching everything from the beginning.
Good choice
What did you think?
0:05 WOW, THAT IS RELATABLE
Bring your girl back to my place and give her that Golden Experience 😎
leaving me with Sticky Fingers
💀
Everyone does realize one of the lead singer's name is Jojo, right?! Amazing!
THANK YOU!
David production is the goat. They are pushing productions to the next level. Every season, they keep taking risks. I like that. Im tired of all these clones. Bringin fresh air. Good job to them !
Araki choose this songs
My mom listens to this song
That's toit
your mom :I play this when I was with your dad
and this how you coming to the world
it's joke
Ah I remember watching this when my mom was near me and when she heard it she just stared at me like WTF
XD
I heard this song at so many of my family cook outs it's insane that it's in my all time favorite series
At the cookouts? Not Frankie Beverly and maze? So sexual for family reunions lmaoo
@@myaann3470 uncle gotta get rhythm from somewhere 😏 (kill me)
@@myaann3470 I’ve been listening to rap music that my parents would play in the car since I was small!
Huh, maybe that’s why I’ve wanted to marry a lady since I was 6! 🤣
When will people learn it’s not going to be the song you want or expect it to be, just because Walk like an Egyptian was a thing. Hell, I was rolling my eyes when people wanted All Star for part 4, just because, hey, 90's. I love this song pick.
IKR? Gansters paradise would be way too obvious. It would be like wanting holy diver for Part 2 of Stardust Crusaders. I'm glad this was their choice.
Exactly. Hell the second ending for stardust crusader was different.
Shock Vox All Star for Part 4 ED? I didn't even think about that.
@@crisgeraldperez7 Its what people thought would be a sure pick for the ending, because hey, 90's. But because it was "obvious" there was no way it'd happen.
So that means I should give up on the idea of Ocean Man for part 6?
Mista’s pose is the zestiest of them all😂
No, Brunos was🤣🤣
Purple Haze Beats em all
DO YOU SEE ABBACHIO THAT POSE IS NOT PHYSICALLY POSSIBLE
na giorno is the most sus one, man was almost grabbing up his own stand
Illuso: *dies in a brutally way*
The ending:
doing the dirty is now a jojo's reference
I bet Jotaro is playing this music while "Studying Dolphins" 😂
it puts the "fabulous" thing in the anime
Between this and Roundabout, I guess I need to finally give JoJo a chance.
Please do it is the best anime periodt.
Araki, you freakin' genius.... you've set the bar once again with this choice of song! You've got colorful taste in many musical cultures, my brother of soul! 😏👍
i can't even be mad that it's not gangsters paradise when they playing jodeci, especially since one of the members name is jojo
I am officially a gangster
No, Gang-Star
A GANGSTER STAR!!!
Get a feeling so complicated.
Get a feeling so 𝒽𝑜𝓇𝓃𝓎
ABAJ
When waking up:
Jojo Part 1: Jonathan Joestar waking up from his bed normally (I saw it from manga)
Jojo Part 2: AYAYAYAY
Jojo Part 3: Kakyoin waking up having a nightmare from Death 13
Jojo Part 4: MORI MORI MORI MORI MORIOH CHO RADIOOOO
Jojo Part 5: Horny
That’s a good one 😂
This was set in a time era where this song was #1 in the charts so they added to the ending credits : GENIUS 💯
I still think about how goated JoJo is for using a Jodeci song on the outro 😭 it's too perfect
This ending was and is utterly fantastic and it really fit well with the part
Especially when it played after Mista's golden experience
>Janitor Mario dies in this episodes.
>>Black Sabbath proceeds to kill Giorno
>>>Episode ends. **Plays Freakin you**
virus Juvera just saw that episode yesterday, I died of laughter 💀
This is the best anime ending ever
the colors mixed with the still poses and jodeci playing in background, this is without a doubt the GOAT of ending credits in all of television…
Jo Jo is now the GOAT Anime for this, don’t at me
Eveytime I close my eyes😭
I WAKE UP FEELING SO HOOOORRRNNNYYYY!
@@Fugo_Pannacotta880PWHAHA
I thought I was tripping wtf lol this is fire 😂
A kid with a dream that’s also Jesus, a mom, a former cop, a guy with 6 kids, a little boy with a plane, some Swiss cheese, and a little girl wearing clothes that no child/teen should wear team up to stop Funtime Freddy.
I described part 5.
My Mom : Son , you don't know real music
Me :
My Mom : oh my god son , you okay?
So how'd it go with your mom?
I do not know ┐( ∵ )┌
Freaky ah outro 😭
JoJo’s Freaky Adventure
KTSK SQUAD 4 GAYS
Here is the link! ruclips.net/video/2MtOpB5LlUA/видео.html
@@justinpsl1391 why?
@@KosdiD because you will love it!
never would i have thought id hear jodeci in an anime lmao
*character dies brutally*
the ending:
Fr
Josuke:AnytimeIneedtoseeyourfaceIjustclosemyeyesandIamtakentoaplacewhereyourcrystalmindsandmagentafeelingstakeupshelterinthebaseofmyspinesweetlikeachicacherrycola
Giorno:EVerY tImE I CLoSe mY eYeS I WaKe Up FeElInG sO hOrNY
Narancia listens to snoop dogg I am dead if you read his personal bio it says his favorite rapper is snoop I am dead af this is why I love jojos and yes I have read the manga
Isn't it Tupac? I could've swore it was Tupac instead of snoop.
@@JoelGarcia-lu3tw i think it was both
@@neevko267
It IS both
I remember when everyone was either happy or disappointed that this was the ending, how we wanted Gangster’s Paradise so much. Now the series has ended and it’s time to get nostalgic
This is a r&b classic my mom would be listening to lol wasn’t expecting for this to be a closing song on a anime like this 😂
WTFFFFFFF😂😂😂IS THIS REAL?!
I see comments kinda like this for the 100th time! Congrats
Yes
Did you watch the anime?
@@funnerfunko Clearly she didn’t. Disappointed.
That was my reaction when I first found out
I wasn't expecting this to happen..
What is life y’all. K-CI and Jojo in Jojo😂😂😂
Dude I was a 90's kid...and this was the jam back then. Still is for me lol. Kind of cool to see it anime. I've seen other songs, but never heard of an R&B song quite like this one in anime.
THE most underrated jojo ED
I hate how a part of Trish's skirt is in the beginning
*no wonder Trish hentai exists*
love how this ending after scene with giorno healing mista
The size of the Grin that slowly crept ear to ear onto my face... JoJo has officially won "Best Anime Soundtrack EVER" Hands down. Let's FREEK!
I can't be the only who body rolled when the ending credits came...
The fact when you think your Spotify started playing and you realize it’s the ACTUAL ENDING SONG. LEGENDARYYYYY
Thanks Araki! Very cool!
thanks for comment
I never thought I’d ever hear a Jodeci song in an anime, and JoJo of all things
* Diovolo dies sad and alone *
* This plays *
"Bossu...please...call me...like you always...have..."
" *EVERYTIME I CLOSE MY EYES I WAKE UP FEELING SO 𝓗𝓞𝓡𝓝𝓨* "
I can't believe this song is a Jojo ending wow.
Best anime ED of all time!
when i first encountered the ending, i honestly thought I kept hitting my play button on itunes by accident. took me about 3 episodes to realize it was the ending theme. it's surreal how two worlds of mine collided. i'm still in disbelief.
Fr bro this is still nuts
Pecci: gets punched to bits by Bruno
Literally 1 second later: