Broccoli + Eggs, 😮 Didn't think that it will be this much amazing || Broccoli Omelette recipe

#broccoliomlette #broccolirecipe #omelette #tastyhours
#lchfrecipe #ketorecipe
#tortilla
Other broccoli recipies
***********************
1. • 🥦 Broccoli Crepes / Un...
2. • Creamy Broccoli Shrimp...
3. • 🥦 Garlic Broccoli Reci...

[@jrch5563]

I love the birds instead of the music and the sound of chopping and noises from the kitchen while preparing the food. Much more relaxing and less busy noise.

[@TastyHours]

Thank you 😊

[@rahulvidhate23]

No waste of time in intros, no off topic talks, no stupid music.
Straight to the point, awesome recipe, and peaceful ambient background sound.
Instant like and sub👍

[@TastyHours]

Thank you 😊

[@ranjitdesai5254]

Couldn't agree more!

[@markp4767]

Please pleaseeee next time also give Measurements in Metric, given those are universal measurements on this planet, rather than just a country or 2. But this is such simple brilliant and healthy recipie to include fresh veggie. I also add some grated Parmeggiano reggiano, or adapt other ingredients into it like sun dried tomatoes or olives. Thanks for this 🖖🏾

[@rogerforest1729]

i know im asking randomly but does any of you know a tool to get back into an instagram account?
I stupidly forgot my account password. I would appreciate any tricks you can give me!

[@danecalvin3339]

@Roger Forest Instablaster ;)

[@BiSAYANGiGAT]

Undeniably healthy and delicious at the same time

[@tatafouzia3543]

Looks délicieux yummy mmmy brocoli wow beautiful recipe blz connecte
Thank you so much welcome

[@kajalsingh9554]

This looks amazing. I have broccoli, and will be making this tomorrow for lunch. I may add some cheese. thank you for making this video.

[@KayDejaVu]

I made this with Just Egg and it was good. I am not totally vegan but love the option to omit eggs. So much you can add to this.

[@KhadidjaRcettes.s]

salut merci pour le partage+1like 👍🌹 🔔🤝🙌

[@Raed10001]

Amazing, thanks for sharing 🌹

[@RecipesbyNabilMum]

Sooooo yummy recipe Just wow yummy recipe 👌👌👌❤️❤️❤️❤️

[@YummydayKorea]

맛있겠어요 Yummy😋

[@AliyahandMommyLDR]

wow omelette broccili looks yummy. i must try this too

[@PiusSpace]

Wowwww lovely and healthy combination

[@saravlogs986]

Wow looks very nice

[@deliciouscookingvlog8261]

Waw sooo Good.. Love to try this

[@SameenasCookery]

wow!! very healthy protein rich recipe

[@dskitchen9190]

Great looking omelette 😍😍😍 looks yummy and healthy 👍🏻👍🏻👍🏻

[@rmnathan5923]

Very nice n delicious.... Tq

[@phoebezhong967]

Thanks for ur sharing ❤️

[@cookunnyne]

완전 대만족 레시피입니다~~
Broccoli and egg!!! What a unique recipe♡♡♡

[@roselilly4897]

Great recipe! Perfect way to get in vegetables! 👍👍

[@fabulousirene]

Awesome recipe. Thank You so much for sharing dear and have a wonderful weekend dear

[@sabasaba1682]

Amazing. Soo delicious

[@DINNERUSA]

looks so yummy

[@DastarKhawanCooking]

Very delicious and healthy recipe 👍🌹

[@dianeely9729]

Yummy keep those quick n easy meals coming.

[@naeemahmed2892]

Excellent and maked short time

[@almaztsegaye8791]

Thank your 4 sharing

[@DeCookingTouch]

very nice presentation and looks yummy

[@EMELIASKITCHEN]

Looks delicious

[@minutestocook]

👍 looks delicious 😋 & simple

[@healthy_foodcooking]

WOW nice I will try it

[@ShielaMarieJacinto]

Healthy recipe, I will try it👍

[@Mavszonetv]

wow my friend this egg and broccoli look so awesome very colorful

[@kishorerama1430]

Wow healthy recipe

[@cookwithjyoti3730]

Very healthe n tasty...

[@palobar9974]

Excellent! Thank you for sharing this recipe.

[@simplecooking192]

Colorful , healthy and super yummy omelette. I must try cooking this too. big likes!

[@chantaltulliez8066]

shall make it looks delicious and healthy...thank you for sharing...

[@recipesforall9780]

Wonderful omelette
liked it

[@destinationdero]

Looks so good friend. like 43

[@CookingSkillzz]

Yumm 😋 i really lk broccoli 🥦

[@glendaliquiran]

i wanna try this healthy and simple dish, thanks for the new idea.

[@CA-sj6oo]

Omg yummy looking!

[@carlsapartments8931]

awesome... i'm hungry

[@fuugawa741]

I must try this.. Tq

[@harshithaartscrafts]

It looks very colourful

[@neetaskitchen1857]

Looks healthy tasty recipe big lykee 👌 thanks

[@varshikaskitchenlifestyletamil]

Delicious egg with broccoli....Yum....Yum....

[@hevesozyilmaz2875]

Looks delicious plus appropriate for the diets, thanks so much

[@GraftingTactick]

Top shelf my friend, it looks so delicious 👍👍👍

[@NovelKitchen]

Healthy broccoli Omlette

[@WonderMomOfficial]

Like 👍👍 very tasty and healthy recipe 😋😋😋

[@wellbeinglife6037]

Wow ~~~
Looks very healthy and delicious food.
Thank you my friend.

[@khoetranst..4391]

very good .yummy yummy .i like it .Thanks for sharing .

[@cookingmeimei8465]

wow so good yummy 👍👍💓💓🤤🤤🤤

[@SumedhaManabaranaKandy]

So easy.... brilliant..💥✍️

[@rubychannel1113]

Wow tq, awesome recipe😘👌👍

[@specialkhanay2359]

Like #35👍😍
Very nice video great share yummy and delicious recipe. I will definitely try to make it . Keep up the good work . You are a great cook 👩‍🍳 💙💚❤️😘🥰💕

[@jekusinatv6958]

This recipe looks so good, and also healthy. I will try this next time. Thank you for sharing this recipe

[@ayemi2556]

Good looking,that must be very tasteful.Thanks for sharing.

[@sumaskitchen8269]

Nice recipe

[@flavoursshore8600]

Wooww.. healthy n yummy recipe

[@newlifethaius4281]

This amazing idea. I’m going to make it thanks for sharing .

[@harilal1441]

Wow... This is a very good recipe for me.

[@jasinthagunawardana328]

Great recipe 🌹

[@Thottavadii]

Wow this looks so delicious 👌👌I must try it 😋😋

[@limewalk6719]

Great recipe. Thanks for sharing :)

[@jamshirana7747]

ഓംലറ്റ് റെസിപ്പി സൂപ്പർ ആയിട്ടുണ്ട് 😋😋

[@Dhspat]

Yummy. ☘️☘️☘️☘️☘️

[@KoreaWalkingVlog]

Looks so delicious. I will try to make it. Thanks for nice video.

[@jamalalexandar2583]

Amazing videos

[@parviish]

Wow looks so yummyy😋

[@dhruvbhatt1876]

Good idea , thanks chef.

[@nooor1120]

Yummy
Thanks

[@AmysWorld4u]

Looks good!

[@vio5054]

👍🏾nice one I'll try it

[@pk2030]

I will try this👍😋

[@AdibaFoodzIndia]

Awesome preparation...👍... TFS

[@simplengbuhayngmaybahay5369]

very healthy thank you for sharing I will try this support and connected

[@independentnews308]

Excellent food

[@chafrewilcha]

This was very tasty!! I've found another great addition for breakfast ... and as a side for lunch or dinner ... or for a late night healthy snack. Thanks a million!

[@FilipinaVanLifeAubry]

I got broccoli I should try this. Thanks for sharing this recipe

[@sumathyperumal605]

Wow looks amazing !

[@pmehta4452]

Bravo!

[@mirzaraziabaig1800]

Very very nice

[@MaltsTime]

Yummy & healthy, love it 💖👌

[@memekjunior3518]

Ok I will try this for breakfast

[@subhanallahrabiyakitchen]

big like 13 .......Owwwwwwwwwwwwwwwwwwwwwwwwwww this is really amazing recipe .... super Yummy mouthwatering recipe share gud work dear watched full tfs

[@PoonamsKitchenMore]

27th like yummy and healthy dear friend keep in touch 👍👍😋 😋👌 👌

[@budekins542]

Definitely doing this!

[@CookingSkillzz]

delicious omelette

[@newhealthyhacks2148]

Awesome...!!

[@arunaatozchannel9546]

Super 👌👌

[@cookinghistory96]

so nice

[@MamatasPavilion]

Green Keto like diet ! superb omlette idea and the qty of broccoli you used is excellent , very healthy breakfast idea ! thanks for sharing, always enjoy watching you at work !

[@gurdeepmaan4434]

Wow NYC respie 😇😇😋

[@indianvlogandrecipe2482]

Very healthy and tasty 😋😋👌👌

[@UhmMaRang]

Hello.
Your Broccoli Omelette
The cooking recipe was so delicious.
I'll go to the end of the video.
I'll find you again next time.
^ _ ^ ~~

[@salalathkoyatty3467]

super,😋

[@delta201delta201]

Fantastic