Homemade Pizza Video Recipe⭐️ | Start to Finish Pizza Recipe with Dough, Sauce and Toppings
HTML-код
- Опубликовано: 16 окт 2024
- #pizzatime🍕 Perforated Pizza Baking Pan at amzn.to/2jttaeu
Kitchen products at amzn.to/2wLsndV
Subscribe: www.youtube.co...
One way to please everyone at the table is to custom-make pizza at home: Prepare a selection of toppings and take orders. Usually, I have to prepare one medium cheese and Large Veggie-lover's Pizza.
These days, it takes very less time to prepare pizza, I should say, less than ordering pizza!!! Plus, kids get to enjoy making their own personal pizza as well...
More recipes at www.bhavnaskitc...
Topics @ www.desiviva.com
Download Bhavna's Kitchen apps for Android, iPhone and iPad
Like me on FACEBOOK / superveggiedelight
Tweet with me on TWITTER / bhavnaskitchen
Partner Websites:
www.indianrecip...
www.veggierecip...
Ingredients
FOR THE DOUGH
Rapid rise yeast 2 Teaspoon
Sugar 1 Tablespoon
Warm water 1 1⁄4 Cup (20 tbs)
Oil 4 Tablespoon (3 - 4 tablespoons)
Salt To Taste
Garlic powder 1⁄2 Teaspoon (Optional)
Dry italian herbs 1 Tablespoon (Optional)
Plain flour 3 Cup (48 tbs) (2 1/2 - 3 cups)
Tomatoes 5 (4 -5 tomatoes)
Red bell pepper 1⁄2
FOR THE SAUCE
Carrot 1 , sliced
Onion 1⁄2 , sliced
Garlic 3 Clove (15 gm) (2 - 3 cloves)
Chopped basil leaves 1⁄4 Cup (4 tbs)
Salt To Taste
Paprika/Chilli powder To Taste
Sugar To Taste (Optional)
Directions
GETTING READY
For the dough - In a mixing bowl, add in the yeast, sugar, warm water, oil, salt, garlic powder and Italian seasoning. Let it bloom for sometime.
Add in the flour and knead with dough hook, using a stand mixer for 6 - 10 minutes.
Spread some oil over the dough and on mixing bowl and let it rise, twice or thrice, about 30 minutes.
For the sauce - in a pressure cooker, add in the veggies and salt. Cook for a few minutes.
Remove the skin of tomatoes and red bell pepper and transfer all the veggies to a blender. Blend until smooth.
Take out the sauce in a medium bowl; stir in paprika, sugar and basil leaves. Set aside.
Punch the dough and take out over a floured surface; knead for a few minutes and divide. Spread over the baking pan and cover with kitchen towel and let it rise for a few minutes.
Preheat oven to 375 degrees F.
MAKING
Spread sauce over the prepared dough sheet and top with cheese and desired toppings.
Bake for 20 minutes or until crust is browned.
SERVING
Slice the pizza and serve. Tired of always eating the same foods over and over again? Checkout my guide at bhavnaskitchen... In this guide, I'll teach you how to cook a variety of vegan and vegetarian recipes using a pressure cooker. This guide was made to make it easy for you to follow along step by step. And if anything goes wrong along the way, don’t forget you can use the search bar for help or send questions to me directly.
For everyone who does not have oven, you can use convection mode on your microwave oven as follows:
Preheat the microwave oven for 10 minutes on convection mode on 200 degrees.
Then put your pizza in it...
Use the black metal plate or net stand that came with your oven to place the pizza little closer to the roof of oven(because heat will come from upper side of the oven).
Now bake on convection mode for 10-16 minutes on 200 degrees according to the weight of your pizza.
200 gm takes 10 minutes.
400 gm takes 16 minutes.
Check your pizza and cook more if needed.
Pro Tip: convection mode dries and makes your food crispy, use it to reduce softness and moisture from your pizza.
If your cheese and toppings are mostly dry, then reduce convection time for 2 minutes and use microwave mode at the end for 2 minutes.
Some microwave ovens come with preset menus, you can use it according to the user manual of your appliance, generally you just need to set temperature and weight for that.
I shared my experience out of interest, please like my comment if i helped you 😊.
Thanks for taking time to share
Thanks for the helpful info👍
@@Bhavnaskitchen and @shubham mishra, you can also make a pizza oven, a pizza stove, and a pizza peel to help you cook a pizza as well, depending on the property codes of where you live.
Its Helpfull
My microwave uses convection and grill at the same time what should I do?
One of the best tutorials ever so far! Provides amazing measurements and visuals, I really recommend this recipe!
Thanks. Great to hear your feedback.
@@Bhavnaskitchen I have ❤️❤️❤️❤️❤️❤️❤️😘👍😘👍🙄❤️❤️❤️
Hello Mai hun aap Kaun Hain jaldi se bataenge Mein Aapki laga raha hun main aapke lover hun
ruclips.net/video/N5aedlw9jIM/видео.html
what bruh
haha ... out of all the videos I watched that claimed to be the best ever ... the one that did not claim to be the best ever (this one) actually appears to be the best ever ... did it and it was great! I only did one thing different after I let it rise and divided them into 2 I let them in the fridge for 3 hours ... then used 1 to make my pizza save the other 1 in the freezer.
Ik Im one year late but HOW LONG DID IT TAKE U TO MAKE THE DOUGH RISE ?
Steve Humphries that woman was the one who made pizza for people in SAN Francisco
ruclips.net/video/SbIOx5c36PY/видео.html
I made this pizza in 2015-16 when youtube/internet wasn’t as popular as today and it was the best recipe available then and the pizza turned out to be mindblowing. Till this date with so much content available this recipe is still the best and easiest to follow.
I was only 17-18 yo at that time so making pizza from scratch was a very huge deal and my friends and family went crazy over the pizza.
Lots of love Bhavna 💕
So glad to hear this. Thank you so much for sharing your feedback, it means a lot to me. 🙏🏻🙌
Found this pizza recipe 6 years ago and I haven't used any other recipe since, hers is very tasty. Deffo the best on RUclips
So glad to hear that. Thanks for your precious feedback.
I screwed up on the base itself. My wife said the base I made can be used as a bullet proof vest for the army wtf
+AJsVIEW Your wife has a good sense of humour lol
+AJsVIEW u r wife is smarter than u lol
+AJsVIEW HAHAHAHAHA
+AJsVIEW be aware tht may be she is ready with a gun to screw you up....
1 like for you
Today I made this, with bit variation. It turned awesome... Cheers
Great..enjoy!
.
my pizza was gud bt didnt get brown..y so
This recipe was awesoooome! The italian herbs made a taste just like pizza hut breadsticks, with the soft, tender and sweet garlic taste! Totally recommend!
So great to hear that
This is the great Spiritual man known traditionalist and spiritualist in Nigeria africa.I'm here to help each and everyone having any spiritual and physical problems. I would walk you through the past footsteps of our traditional ancestors, culture and gods and your life would never be the same.......... WhatsApp me on
+2349137314156)
* Money rituals
* Instant money
* Money ring
* Bucket money
* Lotto numbers
* Wallet money
* Money commands
* Pocket no dry
* Pot of riches
* Business problems
* Gold problems
* Protection
* Bad dreams
* Love spells
* Bring your Ex back
* Land problems
* Court cases
* Examination
* Interview cases
* Chieftancy issues
* Office problems
* Police station case
* Election wins
* Visa problems
* High spirit of pastors
* Cafe or fraud guys
* Brotherhood of money
* Secret society
* High spirit
* Football luck
* Bullet never enter you
* Illuminati kingdom..... Can't mention all so, Whatsapp me (+2349137314156).
NO HUMAN BLOOD INVOLVED
I made this recipe with Whole wheat flour and it came out delicious. I had to ferment for an hour though even with the quick rise yeast. However, it was worth the wait as the recipe turned out to be better than store bought base and also guilt free.
So great to hear that
5 years later and I finally found ur channel and im rewatching this video 😂😍
This video brings back so many childhood memories so...thank u for being part of it🙏🥰
So glad to hear that dear. Thanks for coming back. 💕hope you enjoy my last 5 years videos I have posted. 👌
@@Bhavnaskitchen oh I will thank u!🥰
Thanks for sharing, I made pizza for the wife and kids and they loved it. I have never made pizza before so I was surprised at how well everything turned out. Thanks
So great to hear that
Bhavna your pizza is very nice I will try thank you
My pleasure
You can try this also ruclips.net/video/i6nVHZRlfR0/видео.html
1 I woke up
2 I made pizza
3 it was delicious
4 everyone appreciated me
5 I slept
Now read in sequence 5,2,3,4,1
😀
That was dream
😂
😂😂😂😂😂😂👍
This is the best pizza recipe I tried this 1000 times and it's still taste amazing ❤️ I love it soooooo much thanks for sharing this recipe ❤️❤️I going to make 1 more time😂 I love that soo much. love your videos ✨
Thank you so much for your feedback dear.
Tried this yesterday and it came out just perfect ! Thank you !
+Chitra K glad to hear that
By far the the the the best pizza recipe, saved it years back and still follow it, every time I make pizza 🍕
Great to hear!
Thank you for the measurements that comes in cups/spoons/ grams . Very helpful
👍
Made this today and it's an amazing recipe. One thing though, it took my dough two hours to rise instead of 30 minutes. No big deal, just though I should let other people know. Also, I added a can of tomato paste to the sauce as it was too runny and lacking in tomato flavor. Came out perfect.
Thanks for sharing. Blooming may vary depending on the weather. These days, I add flax meal to thickened the sauce. Works great. Have fun making more pizza.
Pizza baze ghr pe achcha bnta h ?
VJLove BEAUTY three hours or two which one? How many comments you gonna make lol
I warm my bowl a little first. Put dough in and cover with a towel. Rises much faster.
Cecilia Petrowsky cover it with a wet towel!!!!
I'm only 13 but I tried this recipe and my family loved it I'm making it again but I'm going to make 2 doughs because it was so good
Great to hear that.
Ayyy really? That’s nice I’m 14 and I want to learn how to cook 😅💕 and I’m looking for a good recipes 😁
Bruh I'm 9 I can cook everything
im 15 and i cant cook 😃
@@yuh3104
That’s totally okay just take your time and whenever your ready 💕😁
Thanks for sharing...I made it ..it was good and my family like it 👍👍I face difficulty to handling the dough..I mean it’s too soft so ...shape was little not proper..Please give any tips ?
Add less liquid next time
I’m literally drooling just because of this.....
👍👌❤️
Wish me luck imma do this now that the corona virus making all restaurant closing down now I have time to make my own pizza thank u for sharing this recipe 😊
Have some great fun cooking with family
Bhavana kitchenni tried its yummy . Thank you
‘Imma’?
I made it Bhavna, came out very good. Thank you for sharing recipe. God bless you. I wish I can share pic.
You can share pic on my Facebook or Instagram. I love to see it.
Tried it yesterday hands down one of the best dough ever
So great to hear that 👍🙏🏻
3rd time using this recipe! My kids and I LOVE it!!
Great to hear that
ASDFFVNMKHGFREDFGHVBNMSDDWRRVNMKGGERVNMASDFFGVNMKFFEEFCBNNDFGVNNASDDVMKIPHHGRT2BMFSWRVNMDSZNKIP
I like how you cut straight to the chase, I'll definitely try your recipe.
This is the great Spiritual man known traditionalist and spiritualist in Nigeria africa.I'm here to help each and everyone having any spiritual and physical problems. I would walk you through the past footsteps of our traditional ancestors, culture and gods and your life would never be the same.......... WhatsApp me on
+2349137314156)
* Money rituals
* Instant money
* Money ring
* Bucket money
* Lotto numbers
* Wallet money
* Money commands
* Pocket no dry
* Pot of riches
* Business problems
* Gold problems
* Protection
* Bad dreams
* Love spells
* Bring your Ex back
* Land problems
* Court cases
* Examination
* Interview cases
* Chieftancy issues
* Office problems
* Police station case
* Election wins
* Visa problems
* High spirit of pastors
* Cafe or fraud guys
* Brotherhood of money
* Secret society
* High spirit
* Football luck
* Bullet never enter you
* Illuminati kingdom..... Can't mention all so, Whatsapp me (+2349137314156).
NO HUMAN BLOOD INVOLVED
tried this at home. tasted yummy. kids loved it. thanks and best wishes.
Hi Bhavana, can we use wheat flour instead of maida ?? Thanks bunches for wonderful receipe, I have already tried with maida .. it came out very delicious.
So great to hear that. yes you can make with wheat flour but I would roll thin and if possible, mix maida and wheat instead of only wheat
Hello Ma'am, thanks for this recipe. Keeping this as a base, I tried with wheat floor and on dosa tawa and it has come out so well.
Great to hear that
Willl try this
Did you use 100% wheat flour? No all purpose flour??
@@sakshiag0506 Yes, only wheat flour 🙂
Still one of the best video recipe of pizza.
Thank you 🙏🏻
Thanks dear what a healthy sauce no oil I tried it turned amazing God bless you dear
So great to hear that
Mam it was very delicious and what I think ...is the easiest way for making pizza.......thank uuuu
So great to hear that dear. Enjoy!
This gives me confidence. I just might try making one, looks real delicious.
Glad to hear that
This looks so yummy, am gonna try it..... Thanks for uploading .....
Thank you so much for this recipe. I prepared it for my mum and dad and they had a great time
So great to hear that
I also tried it was yummi
Please subscribe my youtube channel for more recipe videos
ruclips.net/user/amita159
Super❤️🙏🤟😜👌😋
U made it very clear. I tried it this evening earlier and it was delicious. Thank you very much God bless
So great to hear that
The Only Thing I love more than Pizza is....
More Pizza
Me too.
The thing that I love more than just more pizza is.... Even more pizza!!!
+Food Recipes she's using keywords that will most likely pop up in a search.
10,000 Subs and N0 VIDE0
10,000 Subs and N0 VIDE0 Aq
Thus recipe is amazing! I tried to make it and I am 9 and it went perfectly! Thank youy!
So great to hear that
@@Bhavnaskitchen Czech
@@Bhavnaskitchen h
Even me i am 9 years to I made this with my grandma
Just did the pizza according to ur recipe. Came out quite nice. Thank you 😘
So great to hear that Nisha.
Can you tell me which yeast did u use? Fiechmann's yeast is quite expensive
I tried it, n trust me I tasted the best pizza ever... 👍🏻
So great to hear that
@@Bhavnaskitchen I am only following this recipe for pizza, even today I made it, each time it tastes equally awesome, thanks for this recipe, it outstands exceptionally well 👍🏻
2:34 blend the vegetables until it smoothes....
*explodes*
Perfect!
👍
Mam I dont have oven or microwave😢😢...I loved this recipe👏🤩🤩😍😍....plzzz tell how to make without oven 🙏🙏🙏
Watch my video of pizza without oven
Plz check this one without oven ruclips.net/video/dpvzkWS6TTA/видео.html
You can make in pan
Marry me. I have microwave 😂😂😂😂
I tried it and ended up with the best pizza everrr thank you so much ❤️
So great to hear that
I just learn now thanks so much
My pleasure
Hey, I am never able to make pizza dough! I just want to know how much time does it take for the dough to rise? Just want a hint so that I can make it accordingly! Also would like to know if quick rise yeast can work? Thanks 😊
Rising time depends on the type of yeast used. I use rapid rise instant dry yeast and it takes about an hour or 2 to bloom
Boiled and blend vegatables was a great touch.
pliskinn0089 Thanks..enjoy!
+Bhavna's Kitchen Wonderful. My mouth watering
akbar mitani
Soumyadeep Banerjee teluguruchulu
I already cook it.so nice.I love it so much
আমি যখন পিৎজা বানাই শুধুমাত্র তোমারই রেসিপি দেখে বানিয়ে থাকি, আমার খুব ভালো লাগে তোমার রেসিপি
গুলো, খুব ভালো থেকো 🤗♥️♥️♥️
Tried this recipe and it turned out great,my daughter loved it. Thanks for the recipe 😊
So great to hear that. I would love to see the pictures next time
@@Bhavnaskitchen tried to add picture but did not see an option
For those of you who do not have an oven, OTG, microwave, etc. Take a kadhai (big pan) add cooking salt in it just 1/5th of the kadhai, place a stand or katori in it and then place Pizza tray on that. But before, cover the kadhai containing salt with a lid and the heat up the kadhai (preheat) for 15 minutes on medium flame first.
This is amazing.. Will definitely give it a try 😁
👍👌
You can try this also ruclips.net/video/i6nVHZRlfR0/видео.html
Delicious and simple pizza. Thanks a lot for the recipe.
My pleasure 😇
Great How to Make Pizza recipe, A lot Better than my video
Subtle self promo :p
Eds Channel
you dont have any pizza recipe video
Eds Channel
Hitesh Divekar no video you have 😑
I love to eat pizza in the morning because it's starts my day off and pizza is my fouvrite food
😀
Y
Mama 999999
Se e rino@@Bhavnaskitchen
It was amazing to see the dough rise
+Sujit Hota enjoy
Bhavna's Kitchen ..best pizza video from scratch..
thumbs up to Bhavnas pizza
time lapse video i guess
Super hit recipe. Thanks for sharing. I will try.
👍👌
This is TOTALLY from scratch! Nice job!
Thanks
I highly recommend this recipe. Everyone try now😍
Thanks 🙏🏻 👍👌
Omg i tried it and it was sooo good like i couldnt even believe i made it.... Thank you for making quarantine so much fun honestly quarantine is getting me to cook and bake and your videos help me so much... Thanks alot
So great to hear that dear
I’m getting so hungry if I see a pizza thanks to show to us
My pleasure
I always see you happily. It is easy to understand and tasty
Nice to hear that
@@Bhavnaskitchen how did you get that dough to rise quick I didn't catch that part but I think you said you put that bowl in water and I right or wrong
We tried it at home, came very nice. Thanks for your help :)
So great to hear that
Hi I enjoyed watching the video and making it in my home with my friends thank you
Great.
Hi, i tried ur rawa dhokla receipe it is too good everyone jus loves it. Can we make this pizza using whole wheat flour
And how to bake in convection oven
love your channel..... mainly because you reply to our comments ❤️
Great to hear that dear
Who us still watching this during corona lockdown🏠
Me
Me
I'm Egyptian and l thank you very much for this pizza ❤❤❤❤❤❤❤❤❤❤
👍👌❤️
Can we do with wheat flour? I tried with your recipe it came out too good. Thanks 😊
Yes
احلي طريقه بيتزا واسهلهم 😍
العربي اللي شاف التعليق تحيه ولايك
ruclips.net/video/f_kbEOp72PU/видео.html Plz subscribe to my channel
ممكن ترجمة بالتفصيل
Dang if i lived with you I wouldn't ever worry about buying or making pizza when you're there 😁😂👍❤️
Who is watching this during lockdown leave a like
This recipe is soo good today I am making this pizza .hope it works ❤. 💜
Would love to hear how it turns out
@@Bhavnaskitchen it's was superr
@@Bhavnaskitchen I tried so many times still this taste good
When your in Lockdown and you can't afford to buy pizza
👍
Gahau
That's right
More like who the F*** trynna buy covid infected pizza idc what you say every pizza place has humans working and somewhere along the day I know they forget to wash there hands. Yes we are humans but sorry chief I’d rather take my chances making one.😁
Exactly 😂😂😂
the ending of video was as a bollywood movie.....lol
ujhggfg
lol...
jarman Cheema palak
That was a beautiful pizza and I'm sure it tasted amazing.
You minorities don't know how to cook a basic pizza
Thank you sis we always come back to your pizza video everytime we want to have pizza. May the Creator fill your life with happiness and joy always.
Thank you 🙏🏻
it's a very delicious pizza I think! and simple but nice I can easily to follow your recipe.thanks!
Chocolate Pizza! instagram.com/p/BNWHV-MBbCi/ Yes, its possible to combine the 2 most beautiful things in the world! Chocolate + Pizza :D Have a good day :p
RUclips
I appreciate your tomato sauce recipe. Love the video
+Ms Cocopiyal 👍
I have seen so many pizza recipes on youtube but i think this the best looking😍 and tasty pizza i ever seen.Even looks better then dominos.
I will definitely try this at recipe.
👍thanks
wow the pizza tastes like dominos pizza 👍👍🍴🏆🏆
Samy Karuppu
Samy Karuppu please tell how cheap it is compared to dominoz
Thank you so much for this great recipe. I made it and my mom loved it and she follows this recipe. She doesn't like pizza from outside anymore cuz of this recipe😂👌
So great to hear that Sanjana. My family also says the same.
Your son is so cute, and he goes like:" This is awesome, 1 to 10, 10 ! " XD~~
😀
Yep! Gotta thumbs up right at that point.
@@Bhavnaskitchen :ioi,b. ov
Lovely and i am Trying it Today.....Wish me Best of Luck
Wish you the best dear
I'd like a companion video where you show us how to male thin base ..... Great video
i am here because of that coronavirus
Don't worry no body will like your comment 😉😁😂🤣🤣🤙
@@night_mode97 😀😀
Same
Me too FOR Eating Some Fast Good Cuz it's Lock down in Pakistan 🇵🇰
@Prodigy Gamer and
Omg this was so helpful !! Thx soooooooo much it was worth it!!
Love from India 😊😊
Great to hear that
Bhavna, I’m making this tonight. It looks yummmmm!! Just a quick Q, when I roll out the dough for the base, do I need to prick it with a fork so it doesn’t puff up while baking? Or should I just roll it out and straight away spread the sauce?
Yes you can prick
Hello
I tried your recipe its amazing
But the thing is the amount of water is too much
I used 1 cup and even then i had to add more flour
You might wanna edit the water amount
The rest your dough recipe is amazing
Water is always depends on the flour as well. I would always add water as I go
So nice I made it today..MashaAllah
Do i nkow u sumaya am tony
Your kids are adorable
Thanks
This is my go to recipe each time i make pizza at home
That's great
That kid At the end of Video 🤣 lol... pizza Was so hard that his teeth was missing🤣🤣🤣
Not hard pizza but nature works, looks like you still have baby teeth🤣
@@Bhavnaskitchen you roasted him well lmao😂
The background music came from my Financial fitness class
Bhavna u r so pretty
Cutie pie, like my little sister 😘
God bless you beta
Thanks dear
This recipe is perfect. I like to flavor the crust also. I am so surprised that crust stays crunchy even when I stored baked pizza is refrigerator for left overs. I also made pretzels from half of the dough. I used baking soda dip and sprinkled salt and butter. The 🥨 pretzels were great. So many items I can bake with this dough love it.
So great to hear that
your child is smile has the everything ...woow my god bless ur hands dear....i just cross ur channeland subscribed it 😍😍👍👍
+Aisha Arawela 👍❤️
the gorgeous lady nice
Looool no clue to what you just commented
How long can we store the sauce ?
Refrigerate for up to 3 days or freeze for up to 3 months
Laderrrrr, Waderrrr, Super hawwt *In trying to be English Accent* :D
I can guarantee that it's not an English accent, perhaps American a bit but definitely not English.
I tried today this pizza and it came out perfect ...thank you bhavana
So great to hear that