Detailed review of KORYO tabletop dish washer in tamil !

Поделиться
HTML-код
  • Опубликовано: 19 окт 2024

Комментарии • 1,1 тыс.

  • @subhaskitchen4387
    @subhaskitchen4387  4 года назад +13

    Hello friends,
    The cost of the dish washer is around Rs twenty thousand. ( Rs 20000).

    • @sankaridevi588
      @sankaridevi588 3 года назад +2

      Mam inum itha use pandriga nala work agutha

    • @mahalakshmi7094
      @mahalakshmi7094 3 года назад

      Aaaaaaa

    • @siveksivek5099
      @siveksivek5099 3 года назад

      Amma ethu problem ellama function akutha

    • @buvikar007wari8
      @buvikar007wari8 3 года назад +1

      Mam purchase panarthu worth service yeppide maintance cost details kuduga

  • @sagintineka7971
    @sagintineka7971 5 лет назад +100

    It is not about waste of money,time , power consuming etc. It's useful, as women get sick after all households doing herself no one helping her and hiring servant is another issue so it's better to buy one like this

  • @urjitbhatt5090
    @urjitbhatt5090 4 года назад +1

    Thanks for sharing
    How is the result
    Can we arrange under the sink not on the top
    How many vessels we can load at one time

  • @GOACHITRASEKHARRECIPE
    @GOACHITRASEKHARRECIPE 5 лет назад +7

    இனிய மாலை வணக்கம் சகோதரி 🙏. சூப்பர் சூப்பர் மிக மிக அருமையான பதிவு. டிஷ் வாஷரில் பாத்திரங்களை பகுதி பகுதியாக அடுக்கி வைத்த விதமும் அருமை. பிறகு அழகாக பளீச் பளீச் என தூய்மையாகி இருந்த விதமும் சூப்பர். மொத்தத்தில் இதனை பயன்படுத்தி அடையும் மகிழ்ச்சியை சகோதரியிடம் காண முடிகிறது. இந்த பதிவை பார்க்கவே ஒரு புது அனுபவமாக இருந்தது. வாழ்க்கை முழுவதும் நிறைய நிறைய சந்தோஷம் பெற வாழ்த்துக்கள் சகோதரி 👏👏👏. சிறப்பாக விளக்கம் தந்தமைக்கு பாராட்டுக்கள். நல்ல பகிர்வுக்கு நன்றி சகோதரி 👌👌👌👍👍👍👏👏👏

    • @subhaskitchen4387
      @subhaskitchen4387  5 лет назад

      இனிய சகோதரிக்கு மாலை வணக்கம். தங்களின் பாராட்டும், வாழ்த்தும் என்னை மெய்சிலிர்க்க வைத்தது. இப்படி ஒரு சகோதரி எனக்கு தந்ததற்காக youtube க்கு ஒரு நன்றி. தங்களின் தமிழ் வரிகளுக்கும், பாராட்டிர்கும், வாழ்த்துக்களும் நன்றிகள் பல... 😊😊

  • @saranyathilak9337
    @saranyathilak9337 4 года назад +4

    not for daily use.but if you're sick.it will help you.Thank you for your demo.😊👌👌

  • @user-pz6et7bi5w
    @user-pz6et7bi5w 3 года назад +4

    Very nice explanation and review.
    This product is not for everyone. Hence, ignore negative comments.
    Let people first wash their clothes by hands and then comment saying that they will wash utensils by hands. Any new innovative idea will first have negative opposition. Same was for washing machines too.
    This product sterilizes all utensils and prevents bacterial infection - unlike handwash. Only disadvantage is that cost is at higher end.
    Very good review and thanks for sharing 🙌

    • @subhaskitchen4387
      @subhaskitchen4387  3 года назад +2

      Thank you so much, at least you understood my purpose of the video. Have a nice day. Take care.... 😊😊

    • @user-pz6et7bi5w
      @user-pz6et7bi5w 3 года назад +5

      @@subhaskitchen4387 You too Mam.
      Next time, neenga bosch vaangunga. Bigger size and much more effective.
      People don't understand how much women work at home and take everything for granted. I am planning to buy one for my wife. Prices ippo jaastiya aagiduchu, due to lock down.

    • @aarthyanandan5712
      @aarthyanandan5712 2 года назад +2

      @@user-pz6et7bi5w u r such a good husband.. so proud of u for your statement..

    • @user-pz6et7bi5w
      @user-pz6et7bi5w 2 года назад

      @@aarthyanandan5712 🙏🙏. I bought a voltas dishwasher and this is a blessing for all of us 🙌❤. It is definitely easier than washing by hands.
      I also bought a electric hand held dishwasher/scrubber for Rs.1400. It helps in removing tough stains and will definitely recommend to all those who wash utensils by hand.

  • @krithiga7464
    @krithiga7464 5 лет назад +12

    I was thinking how to keep a big dish washer in a rental house. Sometimes my working hours extend to 14 to 15 hours a day. After returning home with fully exhausted, seeing these dishes in the sink to be washed will be a high punishment.
    Thanks for sharing information about this product. Might be useful for people who commute to their office long time and long working hours.

  • @s.muthukrishnababu1519
    @s.muthukrishnababu1519 4 года назад +1

    What is the cost of this dishwasher. Do we have to keep only clean utensils in this washer?. How much water does it consumes per wash cycle. Is it suitable for areas with saltwater. How much power does it consume. Is this washer can be only used on table top or it can be kept in shelfed as part of modular kitchen.
    rest it looks as a good product. Thanks for your demonstration.

  • @k.balamurugank2846
    @k.balamurugank2846 5 лет назад +5

    Pathiram....vilakki vilakki bore adhichu...life veruthupoi irupavargalukku thaan theriyum idhoda arumai....very nice review ....office Goers can enjoy a lot....

    • @subhaskitchen4387
      @subhaskitchen4387  5 лет назад +1

      Thank you so much... 😊😊

    • @jaishruthiragumasi3094
      @jaishruthiragumasi3094 5 лет назад

      Rate evlo sollunga pls

    • @k.balamurugank2846
      @k.balamurugank2846 5 лет назад

      17 k

    • @senbasamayal5341
      @senbasamayal5341 5 лет назад +1

      சாப்பிட்டு சாப்பிட்டு கூட தான் போர் அடிக்கிறது அதுக்கு ன்னு சாப்பிடாம இருப்பீங்களா மேடம்.... என்ன மேடம் ஒரேயடியா சீன் போட்றீங்களே....

  • @poonguzhalivengat8870
    @poonguzhalivengat8870 4 года назад +1

    Really u gave a superb explanation...but from my point of view we can wash the whole stuff in just 15 minutes...the cost of buying the machine, maintenance, separate detergent are high.Water consumption is also high...practically not good...

    • @subhaskitchen4387
      @subhaskitchen4387  4 года назад +1

      Thank you dear. That's up to your choice dear... 😊😊

  • @Thirusviews
    @Thirusviews 5 лет назад +10

    Nice review mam...did u wash milk vessel before and keep, u did not show inside of unwashed vessels, so that we could have known the cleaning capacity

  • @SaraswathiMariappan
    @SaraswathiMariappan 4 года назад +1

    Super explanation sis... Very easy ah understand pannika mudinchathu...... Nga..

    • @subhaskitchen4387
      @subhaskitchen4387  4 года назад +2

      Thank you so much for understanding my purpose dear... 😊😊

  • @athiyamandurai3514
    @athiyamandurai3514 5 лет назад +149

    நன்றி... குழப்பம் தீர்ந்தது... இது வேணாம்.

  • @dubeydude7950
    @dubeydude7950 5 лет назад +1

    With great patience u are telling everything, using thz may test our patience.for singles,batchelors it's good only.whats the cost

  • @fathimaabdulhameed7032
    @fathimaabdulhameed7032 5 лет назад +4

    I use a table top dishwasher. It is very convinient. I ussually use a 45 minutes cycle. It does cut your workload

  • @rameshsreedharan3698
    @rameshsreedharan3698 3 года назад +1

    Nice explanation mam, tell me Is it worth using in a water scarce area, any idea of how much water does this machine consume for a programme.

    • @subhaskitchen4387
      @subhaskitchen4387  3 года назад

      Hi, thank you, this machine consume's only 5 litres of water per wash. But you need continuous water supply through the pipe. You can't pour the water and use it.... 😊😊

  • @hemakrishna7478
    @hemakrishna7478 5 лет назад +3

    Madam pls do give us foll details
    Cost of the dish washer
    Cost of the detergents used
    Current consumption
    Is there a option for not using the heater
    Must we remove the residue from vessels before washing

  • @bharathvansh5127
    @bharathvansh5127 Год назад

    Madam,
    How many 3 liter vessels we can keep inside?

  • @prajwalpp123
    @prajwalpp123 4 года назад +3

    I don't understand a word of Tamil / the language she spoke, but I understood everything .. very well demonstrated.. better than any professional video. Great video. Double thumbs up..

    • @subhaskitchen4387
      @subhaskitchen4387  4 года назад

      Thank you so much for your valuable comment and support.... 😊😊

  • @jasonsanjay2911
    @jasonsanjay2911 4 года назад

    Good but What happened to Plastic coffee fillter y not show when it clean?

  • @joshinim.n9863
    @joshinim.n9863 3 года назад +6

    Can you do a review of this after one year? It'll be very helpful.

    • @PrizysKitchen
      @PrizysKitchen 3 года назад

      NICE. Am your new subscriber.i subscribed your channel please subscribe my PRIZYS KITCHEN U TUBE CHANNEL. THANK YOU SO MUCH

  • @MantraAndMeditationRNkitchen
    @MantraAndMeditationRNkitchen 4 года назад

    Very nice How much this one. Comparetiveli it is small and compact table top

  • @Hss922
    @Hss922 4 года назад +7

    Husband is very thoughtful for giving this to you as a birthday gift( if thats what you said.) ...

    • @subhaskitchen4387
      @subhaskitchen4387  4 года назад

      Thank you dear for your valuable comments. Have a nice day.... 😊😊

  • @manimegalai6148
    @manimegalai6148 3 года назад +1

    Hai madam. ...dish washer so suuuperb ma dear. ....rate sollavilliye ma how much ma sis 👌 sollunga plzz 👍🙋🌷🌹💝💙💜

    • @subhaskitchen4387
      @subhaskitchen4387  3 года назад +1

      Hi dear, i forgot to tell the price. So only I had already pined the price of the dish washer (Rs 20000). Thank you dear... 😊😊

  • @lakshminagappan965
    @lakshminagappan965 5 лет назад +5

    Very nice video. Only one rack which is compact. Please tell us price of this product. Thank you.

    • @subhaskitchen4387
      @subhaskitchen4387  5 лет назад +5

      Actually the price was Rs 24900, and the offer price was Rs 19990. We bought it in amizon online only. Thank you dear.... 😊😊

    • @sp-vv8em
      @sp-vv8em 4 года назад +1

      Mam thanku good information given.can we wash water bottles?and pressure cooker.ididnt understand ur language but little bit ok

    • @bvmk
      @bvmk 3 года назад

      @@sp-vv8em cooker ok, but bottles not

  • @teteveteveyen9471
    @teteveteveyen9471 5 лет назад +2

    Good birth day gift just for Rs 20,000. Thanks for your sir. Big relief from d servant maid. Like fridge, washing machine, mixy and wet grinder It is very very essential in alll modern kitchen to support house wife. Good information . thank you sister.

    • @subhaskitchen4387
      @subhaskitchen4387  5 лет назад

      Thank you so much bro, at least you understood the fact and the problem of a woman.... 😊😊

    • @teteveteveyen9471
      @teteveteveyen9471 5 лет назад +1

      @@subhaskitchen4387 welcome sister. I feel very pleasure on receiving your special thanks message . All the responsible family heads will know the struggling tedious points in their kitchen. Good hygienic hitech house keeping is an art. It will reduce the health disorders and hospital expenses. You done well. Keep it up.

    • @subhaskitchen4387
      @subhaskitchen4387  5 лет назад

      Hi bro, your words are certainly right. Thank you once again dear bro.... 😊😊

  • @rifatfatima2907
    @rifatfatima2907 5 лет назад +67

    Guys its really uselesa dont waste ur money on this thing.

  • @ST-oh6zw
    @ST-oh6zw 4 года назад +2

    Hi Subha mam....very well explained...Just 2 dounts....
    1. Does it consume very high electricity? Is there any major difference seen in the bill? Since it takes 1 & half hr.
    2. Does it require very high pressure water supply or any normal low pressure taps will also be fine to use?
    Please suggest on these 2 doubts...

    • @subhaskitchen4387
      @subhaskitchen4387  4 года назад +4

      Thank you sir,
      1. No, it consumes normal current just like washing machines.
      2. Normal water supply is enough.... 😊😊

    • @ST-oh6zw
      @ST-oh6zw 4 года назад +1

      @@subhaskitchen4387 Thank u so much mam

    • @sharadhasubramanian462
      @sharadhasubramanian462 Год назад

      How is the service. Tell me the length and breadth and height plse thank you

  • @மகாலட்சுமிராமன்

    நீங்க ரொம்ப கொடுத்து வைத்தவர்கள் வாழ்த்துகள்.

    • @subhaskitchen4387
      @subhaskitchen4387  3 года назад +1

      மிக்க மகிழ்ச்சி தோழி. இந்த நாள் இனிய நாளாக அமைய வாழ்த்துக்கள்... 😊😊

  • @rasheer8178
    @rasheer8178 4 года назад +1

    Is ur dishwasher working good even now mam. Without any complaints n service issues

  • @praweendalmia
    @praweendalmia 5 лет назад +11

    Very detailed review. Although language was an issue for me still was able to see it and understand everything. Thanks :)

    • @subhaskitchen4387
      @subhaskitchen4387  5 лет назад +1

      Thank you so much dear.. 😊😊

    • @pankajashanbhag6109
      @pankajashanbhag6109 4 года назад

      Same language is issue nd how to order

    • @praweendalmia
      @praweendalmia 4 года назад +1

      @@pankajashanbhag6109 I purchased it from amazon and been using it for few months. It is a very good product. Go for it

  • @seeba290
    @seeba290 3 года назад +1

    Super review Madam..how is the machine now?still going fine?

    • @subhaskitchen4387
      @subhaskitchen4387  3 года назад +1

      Thank you so much. Good day... 😊😊

    • @seeba290
      @seeba290 3 года назад

      But how is the dishwasher mam after two years of use?,🤔

  • @AUSSIEtamilkids
    @AUSSIEtamilkids 5 лет назад +26

    Superb review and neat explanation! Step by step clear cut review dear! Hopefully it will share with your kitchen work load! Happy to see your new kitchen friend! Dish washer is an excellent helping machine for ladies during sickness, pregnancy and child birth times when there is no people to help them in kitchen works! For concerns with time consumption, we can use quick wash settings and it works wonderful! There is also lots of problems with hiring people and they requires fixed time schedule and payments for extra works! If have loyal people to help in kitchen, then the work can be shared! Otherwise dish washer is the best option! You explained completely dear and there is no doubt!

  • @balanaga4484
    @balanaga4484 5 лет назад

    What is the price of the dish washer? Is the company people shows demo? If any problems arises to whom.we have to give complaint and ask.for restoration? Last shall we keep in a table? Your description bis best.

  • @nadeemakhter6346
    @nadeemakhter6346 5 лет назад +3

    Good morning my sweet friend
    Haw are you
    Nice buy a things I have also this one last three years
    So nice thing
    Thnx too share video
    Lovely thing

  • @iniyashree1210
    @iniyashree1210 4 года назад +1

    Are you still using this dish washer mam? How is it functioning now? Vangalama?

    • @subhaskitchen4387
      @subhaskitchen4387  4 года назад +1

      Yes dear, i am still using the same dishwasher and it is working fine. Surely you can buy it. Good day... 😊😊

    • @iniyashree1210
      @iniyashree1210 4 года назад +1

      Thank you 😊

  • @ASMcakekovilpatti
    @ASMcakekovilpatti 5 лет назад +10

    Nice amma😊 good explanation😊

    • @subhaskitchen4387
      @subhaskitchen4387  5 лет назад +1

      Thank you dear.. 😊😊

    • @siveksivek5099
      @siveksivek5099 4 года назад

      Senba akka unga veetil dishwasher eruka .ana dishwasher best brand name reply panunga

  • @sangeethasaravanan9776
    @sangeethasaravanan9776 5 лет назад +2

    Super demonstration, romba alaga explain panringanu superb👌, but enaku ivalo porumai kedaiyathu, paathirangala machinla adukra timela manuvalave seindlam

    • @ijeethangamuthu4243
      @ijeethangamuthu4243 4 года назад

      Pls dont purchase koryo products very worst and cheep materiel i purchased fan from big bazaar at tirunelveli
      Twotimes i replaced but not working working

  • @sujathasaravanan9551
    @sujathasaravanan9551 5 лет назад +3

    Plastic vessels like Tupperware products clean pannallama madam

  • @jayasreekodumba1043
    @jayasreekodumba1043 4 года назад +1

    All the vessels seems to be clean . Do we have to wash it once before loading?.

  • @ajithassamayal
    @ajithassamayal 4 года назад +3

    KORYO tabletop dish washer working upload, Soo good,Best wishes

  • @geethav8571
    @geethav8571 4 года назад

    Width n breadth inches solla mudiyuma?
    Sink pakkathileye antha tiles mele vaikka place pathuma

  • @viswabanu1814
    @viswabanu1814 5 лет назад +38

    1.30 hours yellam too much time and water, power waste. First tell the power consuming current bill yavlo varum nu sollunga

    • @naseemakla3944
      @naseemakla3944 5 лет назад +2

      Xactly even I think the same

    • @kokilamurugan4510
      @kokilamurugan4510 5 лет назад +7

      Actually usage of water less , it saves our time also.

    • @subhaskitchen4387
      @subhaskitchen4387  5 лет назад

      Thank you so much Koklia murugan dear... 😊😊

    • @dhanalakshmiyukesh9853
      @dhanalakshmiyukesh9853 5 лет назад +2

      @@subhaskitchen4387 waste

    • @SmoothingLifeByHuda
      @SmoothingLifeByHuda 4 года назад +4

      I too thought dishwasher is a waste until I started using..... My word to all women is if your financial condition is good go for it.... Cause it saves our time and energy....It's not difficult at all. Roughly rinse the vessels under tap water and store it in a basket... Load the dishwasher once a day... Go for Bosch brand and always use only tablet... This gives a long life to the dishwasher.... Power consumption Is less. And the water is used 60-70% lesser than hand wash...the dishes turn out new in every wash... Other than mud pot and iron kadai all the other dishes can be cleaned..

  • @da1681
    @da1681 4 года назад +1

    Ma'am I don't understand the language but still found your video very helpful. I am planning to buy the same model. Can you give me an update if the machine is still working fine and whether after sales service is good. Thank you

    • @subhaskitchen4387
      @subhaskitchen4387  4 года назад +1

      Hi dear, thank you. I am using this dishwasher for almost one year. It is very compact and easy to use. Since it is brought from amazon and plug in model, i don't know about the service... 😊😊

    • @da1681
      @da1681 4 года назад

      @@subhaskitchen4387 Thank you for the feedback. I am planning to buy this very model from Amazon.

    • @suman9686
      @suman9686 4 года назад

      @@da1681 try Voltas beko. Similar one but little spacious in same range

  • @kalaivani8355
    @kalaivani8355 5 лет назад +66

    Mam don't mistake me,. Ungala thappu sollala. But my opinion 10 to 15 mins la kaluva vendiyatha one and half an kaluvuthu. waste of time. But very good explanation mam. Thanks

    • @subhaskitchen4387
      @subhaskitchen4387  5 лет назад

      Thank you dear...😊😊

    • @prabhakaranganapathy34
      @prabhakaranganapathy34 5 лет назад +8

      And waste of water mom. This wont suits to our country. Already scarcity for water. And also auro filter it gives 40% pure and 60% residue. To show us pride among others we r wasting water unnecessarily

    • @aishwariyaajith9850
      @aishwariyaajith9850 5 лет назад

      @@prabhakaranganapathy34 water consumption hand la wash panratha vida kamithan but power consumption more

    • @syedsaleem2361
      @syedsaleem2361 5 лет назад +1

      Enna eppadi.sollitteenga.one and half hour Moonu serial pakkalam

    • @salomimariasacademy2809
      @salomimariasacademy2809 5 лет назад +1

      How can we clean our pressure cookers and Does Tawa.

  • @vichaarsanhitaandspiritual4493
    @vichaarsanhitaandspiritual4493 3 года назад +1

    Very nice video hai dear ji kya bat hai beautiful awesome fantastic super amazing and excellent.hari om hari om.👍👍🌹🌹🤝🤝🥀🥀✌️✌️🌺🌺🙌🙌💐💐🙏🙏🌿🌿👌👌

    • @subhaskitchen4387
      @subhaskitchen4387  3 года назад +1

      Thank you so much dear. Have a great day... 😊😊

  • @Michutlasamayalandshopping
    @Michutlasamayalandshopping 5 лет назад +9

    Good review sis 🙏🙏 thank you for sharing 👌👌👌💓😍

  • @smajismaji3470
    @smajismaji3470 2 года назад

    Akka epo unga diswasher apadi eruku nalla eruka yanakum vanga asaiya eruku,my hus ethu adikadi repair akum nu sonanga pls reply

  • @aswinikthangalakshmi8263
    @aswinikthangalakshmi8263 5 лет назад +213

    15 நிமிசமே அதிகம் இவ்ளோ பாத்திரம் கழுவ,... 1.30 மணி நேரம் னா ரொம்ப அதிகம்.... பேசாம நான் கையாலயே கழுவிக்கிறேன்

    • @rajayouth4940
      @rajayouth4940 5 лет назад +1

      Sapdra paathram wash panna lazy

    • @umashank2010
      @umashank2010 5 лет назад +2

      Correct

    • @jeyashreeshivanim928
      @jeyashreeshivanim928 4 года назад +6

      Wash panna pottu Vera velai pogalamla.. pakkathulaye ukkara vendamla

    • @naveenpujari8996
      @naveenpujari8996 4 года назад +3

      why u watched video.. learn to appreciate . never watch any youtube video and clean yours utencils all time.

    • @shanmuhapriyapriya8156
      @shanmuhapriyapriya8156 3 года назад +1

      நானும் தான்

  • @SupergirlSandhya
    @SupergirlSandhya 4 года назад +1

    super video.. thank you so much.. You have such an understanding and caring husband😊😊

    • @subhaskitchen4387
      @subhaskitchen4387  4 года назад +1

      Thank you so much dear. Have a great day today... 😊😊

    • @SupergirlSandhya
      @SupergirlSandhya 4 года назад +1

      @@subhaskitchen4387 thank you once again :) you too have a great day!!!

  • @savithamahesh6579
    @savithamahesh6579 4 года назад +2

    Those who are not well in health its very useful

    • @subhaskitchen4387
      @subhaskitchen4387  4 года назад +1

      Thank a lot dear, atleest you are able to understand...... 😊😊

  • @MrsPriyaJai
    @MrsPriyaJai 4 года назад +2

    I'm seeing so many negative comments below.
    Pls understand, for elderly people who wants to manage themselves, its for them.

    • @subhaskitchen4387
      @subhaskitchen4387  4 года назад +2

      Thank you so much for understanding my purpose of making this video dear.... 😊😊

  • @nithyad4008
    @nithyad4008 4 года назад +6

    Thanks for the demo however, I think you have missed out to share some vital informations such as
    1) Dish wash volume
    2) Price
    3) Before placing the vessels the condition of vessels we're not shown
    4) Power consumption and time for all the programs
    5) All consumables price and their sources
    6) Cost of consumables as claimed by the company per dish volume of wash
    7) Whether hard wash is capable of cleaning burnt vessels like milk pan and other cooking vessels
    8) Description given in the video for various programs were inadequate
    9) Post cleaning requirement if any for the dish washer
    10) Does the washer require 90 minutes for quarter, half load volumes etc.,
    11) Capacity and price variants for the product with the vendor.
    Inspite of above shortfalls still the video was useful. Thanks for your effort and the interest you have shown in sharing the video.

    • @subhaskitchen4387
      @subhaskitchen4387  4 года назад +1

      Thank you for your comments and suggestions... 😊😊

  • @kumarianandhavelu2700
    @kumarianandhavelu2700 Год назад

    Mam, ippa dishwasher performance epadi iruku sollunga please. Na ithu vengalam nu iruken so please reply

  • @LS-JULIE
    @LS-JULIE 5 лет назад +82

    உங்க வியூவ்கு நன்றி அம்மா, ஆனால் இதுல வேல பார்க்குறதுக்குள்ள எங்களுக்கு டென்ஷன் எகிறிடும் போல..

    • @bhuv2232
      @bhuv2232 4 года назад

      😄😄😄

    • @dhevahianbazhagan8954
      @dhevahianbazhagan8954 2 года назад

      ஆமாங்க டென்ஷன் அதிகரிக்கும்

  • @annunciawilliams1680
    @annunciawilliams1680 2 года назад +1

    Romba good and positive reviews kodutjirukinga

  • @brabubrabaa8727
    @brabubrabaa8727 5 лет назад +17

    1.30hour Carrent bill enna aakum. Etha adukkura neradula 10mins velagiralam. Edula wash panna sapta putiggadu

    • @SmoothingLifeByHuda
      @SmoothingLifeByHuda 4 года назад +6

      I too thought dishwasher is a waste until I started using..... My word to all women is if your financial condition is good go for it.... Cause it saves our time and energy....It's not difficult at all. Roughly rinse the vessels under tap water and store it in a basket... Load the dishwasher once a day... Go for Bosch brand and always use only tablet... This gives a long life to the dishwasher.... Power consumption Is less. And the water is used 60-70% lesser than hand wash...the dishes turn out new in every wash... Other than mud pot and iron kadai all the other dishes can be cleaned..

  • @timone1423
    @timone1423 4 года назад

    Very slow and clear explanation..i think since you selected P5 mode, it took nearly 1.5 hrs.. i believe other modes might take lesser time.. please let us know how much time other modes takes..

  • @Musically_deeps
    @Musically_deeps 5 лет назад +3

    How much is this? 2 hrs aaguma? Total time waste

  • @subhasissen8868
    @subhasissen8868 5 лет назад +1

    Subha'skitchen mam this dishwasher can clean copper,aluminum,microwave plastic bowl.please answered the question.

    • @subhaskitchen4387
      @subhaskitchen4387  5 лет назад +1

      Hi dear, it can clean everything. Thank you. ... 😊😊

    • @shantimohan4840
      @shantimohan4840 5 лет назад

      No ma copper, aluminium ellam colour change ayidum. Adhellam poda kudadhu
      Tupperware glassware idellam nalla wash pannum

  • @priyadarshiniraj23
    @priyadarshiniraj23 5 лет назад +6

    Hi mam nice review from how many years ur using this
    Pls reply

    • @subhaskitchen4387
      @subhaskitchen4387  5 лет назад +1

      Thanks dear, i brought it in jun and still now I am using it.. 😊😊

    • @iyappaniyaps9395
      @iyappaniyaps9395 5 лет назад

      @@subhaskitchen4387 hi mam thnkx fr ur videos
      How much tat salt rate and liquid

  • @nagarohinikumarichimakurth7916
    @nagarohinikumarichimakurth7916 4 года назад

    Madam can we put aluminum cooker, kadai in this machine

  • @Madraswala
    @Madraswala 5 лет назад +53

    அந்த உப்பு, liquid, எவ்வளவு முறைக்கு ஒரு முறை மாற்ற வேண்டும்? என்ன விலை? பவுடர் என்ன விலை? டிஷ் வாஷர் என்ன விலை என்று தேவையான விவரங்களை சொல்லவில்லை.
    குடுத்திருக்கான். வைத்திருக்கான் என்றெல்லாம் விவரித்தீர்கள். யார் அவன்?☺

  • @suru7507
    @suru7507 4 года назад

    Whysalt and other liquid are to be used? Not seen in other dish washer.
    How much is the cost?

  • @luckyboymom8105
    @luckyboymom8105 5 лет назад +6

    Don't put fake reviews.wash pana patharam thirupi wash pana mari iruku.

  • @padmavathip663
    @padmavathip663 4 года назад

    Will it wash neatly without any soap dirt left

  • @rubansiva7984
    @rubansiva7984 5 лет назад +279

    இப்படி அடிக்கிற நேரத்துல பாத்திரங்களை விளக்கி கழுவி முடிச்சிடலாம் மேடம் ..

  • @user_2328
    @user_2328 5 лет назад

    Power consumption pathi solunga... Apuram wash panna water naraya selavaguma

  • @raghavannambiv9964
    @raghavannambiv9964 4 года назад +3

    Who are all cleaned these many vessels in 10 to 15 min they're all genius, maximum we are all using cold water to vessels cleaning, but dishwasher using hot water for cleaning when compared to manual cleaning water saved in dish washer, for example now a days some many people using hand shower for toilet purpose but in manual process people's wasted half bucket water in reality

    • @subhaskitchen4387
      @subhaskitchen4387  4 года назад +1

      Hi dear, this is the actual fact, but no one understand it. Thank you dear... 😊😊

  • @rajamnarayanaswamy9813
    @rajamnarayanaswamy9813 4 года назад +1

    For loading, have we to wash the vessels before loading.clariffy.

    • @subhaskitchen4387
      @subhaskitchen4387  4 года назад +1

      Good morning, no not necessary except for tough stains.

  • @preethir2165
    @preethir2165 4 года назад +5

    💯 percentage clean namma kannuku.. aana thanni selavu, current selavu, time adigama edukuthu idha calculate panna dish washer namaku set aavadhu 😅

  • @somasundaramshanmugam3876
    @somasundaramshanmugam3876 4 года назад +2

    Sis,Good review but you didn't give its price, warranty, available shops, made in and usage of electricity and water. Please explain.

  • @gomathimeenakshi784
    @gomathimeenakshi784 5 лет назад +8

    வெட்டி வேலை.கடகடனு கைல தேச்சுடலாம்..ரொம்ப மினி சைஸ் வேற.Waste of time and currant..bosch brand thaan best

    • @subhaskitchen4387
      @subhaskitchen4387  5 лет назад +2

      Hi dear, கடகடனு கையால் தேய்க்க முடியாதவர்களுக்கு தான் உதவிக்கு dishwasher தேவை, அதிலும் குறிப்பாக, இடம் பற்றாகுறை யாக இருப்பவர்களுக்கு தான் இந்த குட்டி dishwasher. Bosch brandக்கு மட்டும் time and current தேவைப்படாதா?. யோசியுங்கள் தோழி... 😊😊

    • @gomathimeenakshi784
      @gomathimeenakshi784 5 лет назад +1

      @@subhaskitchen4387 yentha dish washerume yennoda choicela illai.இது என்னோட தனிப்பட்ட கருத்து..உங்களை நான் Dish washer use பண்ணாதீங்கனு நான் சொல்லவே இல்லை.

    • @gomathimeenakshi784
      @gomathimeenakshi784 5 лет назад +2

      உங்களுக்கு வீடீயோ போட உரிமை இருப்பது போல் கருத்து சொல்வதற்கு எனக்கு உரிமை இருக்கிறது..மனது புண்பட்டு இருந்தால் மன்னிக்கவும்... Feel so sorry.

    • @shanthiduraiswamy6085
      @shanthiduraiswamy6085 5 лет назад

      Yes me too of the same opinion

    • @shantimohan4840
      @shantimohan4840 5 лет назад

      @@subhaskitchen4387 true ma. Idhu lapt la irukra oily vessels eh kuda suthama clean panni pudusu pola kuduthurum. Nammala apdi theika mudiyadhe ma

  • @vasanthig1005
    @vasanthig1005 3 года назад +1

    Hello!!!this is my first watch of ur video....how is this dishe washer now? It's been 1 year so please tell whether its worth in long run

    • @subhaskitchen4387
      @subhaskitchen4387  3 года назад +1

      Hi dear, certainly i worth it. It's very very useful in my kitchen.... 😊😊

  • @vijayani3222
    @vijayani3222 4 года назад +17

    Don't waste time money electricity bill and time waste hand wash best

  • @ashwinichandramouli
    @ashwinichandramouli 4 года назад +1

    Is there any manual.filling water for washing ie if no water supply I use matching manual.filinng na ?

    • @subhaskitchen4387
      @subhaskitchen4387  4 года назад +2

      Hi dear, sorry there is no option to use it manually... 😊😊

  • @parvathyviswanath9202
    @parvathyviswanath9202 5 лет назад +6

    Super 👌 👌👌 👌 table top first time pakkaren,new

  • @sumathig9086
    @sumathig9086 3 года назад

    Did you check TDS.... before demo

  • @ng3miruthula561
    @ng3miruthula561 5 лет назад +7

    Romba time aguthu mam ...... Time surukkama podunga.... Anna nalla irukku mam.....

  • @travelwithbala2335
    @travelwithbala2335 3 года назад +1

    நல்ல பயனுள்ள பதிவு நன்றி

    • @subhaskitchen4387
      @subhaskitchen4387  3 года назад +1

      மிக்க நன்றி தம்பி. இந்த நாள் இனிய நாளாக அமைய வாழ்த்துக்கள்... 😊😊

  • @saravanankumar7325
    @saravanankumar7325 4 года назад +10

    வேலைக்காரி னு ..சொல்லாதிங்க..மேடம்....அவுங்களும் மனுஷங்க தான்😡😡😡

  • @senthilvaniselvaraj3797
    @senthilvaniselvaraj3797 3 месяца назад

    Aluminium paathiram vaikalaama?

  • @kayalvizhiadhithan3894
    @kayalvizhiadhithan3894 5 лет назад +4

    How much mam?

    • @subhaskitchen4387
      @subhaskitchen4387  5 лет назад +3

      We brought it in amizon online only. Actually the rate was Rs 24900, and the offer was Rs 19990..... 😊😊

  • @mallikarajan1529
    @mallikarajan1529 4 года назад

    Can u pl. Confirm it if u r keeping the vessels in machine with pre wash and scrubbing.

  • @priyasadupangarai2941
    @priyasadupangarai2941 4 года назад +3

    Superb

  • @guna9079
    @guna9079 2 года назад

    Ippavum entha problem illama work aguthugala dishwasher

  • @sangeethasuresh5151
    @sangeethasuresh5151 5 лет назад +16

    I bought b4 2 years ago..... It was not cleaning properly.... Waste of money only....

  • @kumaronholiday
    @kumaronholiday 3 года назад +1

    how is the performance now?

  • @divyasubash9423
    @divyasubash9423 5 лет назад +46

    Hi its useless friend, avaga already oru vatti alasi than pottu irukaga, paal pathiram vaikum pothu avaga kattala but wash pannitu katraga, useless

    • @priyankaatapaka4098
      @priyankaatapaka4098 5 лет назад

      S Divya exactlyy

    • @sunblaze8088
      @sunblaze8088 5 лет назад +8

      All dishwashers from all over the world work that way only. But work will be reduced by 75percent. You can save half an hour work for small amount vessels and 45 minutes for large amt vessles with big dishwasher . I have a big ifb. Very essential when your house help is off on leave.

    • @subhaskitchen4387
      @subhaskitchen4387  5 лет назад +1

      Thank you so much dear, for answering... 😊😊

    • @anuvraman
      @anuvraman 5 лет назад +5

      Always boil little water in the vessel in which you want to boil milk. When it is boiling, add milk and boil. It will avoid bottom getting burnt and dishes come out clean from the dishwasher too.

  • @abi9634
    @abi9634 5 лет назад

    Video was nice... But paathram endha alavukku pisukku irukkunnu katave illaye..adhu thane mukkiyam... Romba lenghthyah illama konjam shortah podunga mam..

  • @varshikaskitchenlifestyletamil
    @varshikaskitchenlifestyletamil 5 лет назад +3

    Correct ah tokar adichiduvanga 100%right....😀😀🤣😄

  • @nagasubramanianpasupathi850
    @nagasubramanianpasupathi850 4 года назад

    Thanks mam,for a detailed explanation,but u could added two things,1)the cist of cleaning agents u added,and 2) if service and spareparts available not only in chennai,but all over tamilnadu

    • @tssampathkamal4688
      @tssampathkamal4688 4 года назад

      I have also purchased days back lie to KDW1483DIW DISHWASHER it is very very useful and helpful. Now it is very easy simple way to use dishwasher thank you for your kind information it is very nice

    • @tssampathkamal4688
      @tssampathkamal4688 4 года назад +1

      Lot to dishwashet

    • @tssampathkamal4688
      @tssampathkamal4688 4 года назад

      Koryo dishwasher

  • @shruthisitaram-saishree602
    @shruthisitaram-saishree602 5 лет назад +24

    She is keeping washed vessels inside the machine

    • @marygrace9638
      @marygrace9638 5 лет назад

      No madam dish washar vessels very clean very shiny but we have to rins vessels first .I used 12years dish washer

    • @vijayakumarclk7350
      @vijayakumarclk7350 4 года назад

      Marygrace Madam, unga comment subas kitchen parthen neenga twelve years use pannreengaendru sonnenga entha dishwasher use panreega.please answer me. Ennoda no9095620000.

  • @shreyubala5138
    @shreyubala5138 3 года назад +1

    One and half hrs oduchuna water usage evlo irukum mam

    • @subhaskitchen4387
      @subhaskitchen4387  3 года назад +2

      Just normal less than you wash by hands.... 😊😊

  • @SimplyNailartbyKarishma
    @SimplyNailartbyKarishma 5 лет назад +5

    2 like
    Beautiful share! 👍☺️☺️

  • @madhumithaselvakumar3259
    @madhumithaselvakumar3259 3 года назад

    Mam for how many times we can was with that 1kg salt approximately

  • @PositiveVibesOnly51
    @PositiveVibesOnly51 5 лет назад +5

    Already clean pana Mahthiri iruku. Atha Thirumba kaluvureenga

  • @naveenpujari8996
    @naveenpujari8996 4 года назад +1

    ஹலோ மேடம், கொரோயோ பிராண்ட் பாத்திரங்கழுவி 1 வருடத்திற்குப் பயன்படுத்தியபின் உங்கள் கருத்து எவ்வாறு உள்ளது என்பதை தயவுசெய்து என்னிடம் சொல்ல முடியுமா, மேலும் வடிகால் குழாய் மற்றும் நுழைவாயில் குழாய்க்கு நீங்கள் எவ்வாறு பொருத்தினீர்கள் என்பதையும் எங்களிடம் கூறலாம்.

    • @subhaskitchen4387
      @subhaskitchen4387  4 года назад +2

      Hello friend , மிகவும் அருமையான முறையில் பாத்திரம் கழுவுகிறது. இரண்டு குழய்களும் பின் பகுதியில் இணைக்க, திருகி மாட்ட வேண்டும்... 😊😊

  • @dhanalakshminagesh3456
    @dhanalakshminagesh3456 5 лет назад +3

    We can wash this within 15 min

  • @travelwithbala2335
    @travelwithbala2335 2 года назад +1

    பயனுள்ள பதிவு நன்றி 🙏

    • @subhaskitchen4387
      @subhaskitchen4387  2 года назад +1

      மிக்க நன்றி தோழரே... 😊😊