15 Years Old Hardworking Kid Selling FRENCH FRIES 🍟 Street Food Afghani Fries Recipe Making
HTML-код
- Опубликовано: 18 авг 2023
- RUclips Top Viral and Trending Video Hardworking Afghani Boy Making Perfect OPTP, KFC & McDonald’s Style Crispy French Fries Recipe. 15 Years Old Afghani Kid Cooking & Selling Afghani Fries. Pakistani Street Food Potato Aloo Chips Finger Fries Recipe Making
Address : GujarNala Nazimabad Block 2 Karachi
For more details Contact Us : Connect.rashidahussain@gmail.com
Follow us :
Facebook: / musttastefood
Instagram: / rashidahussainbhimani
Facebook: / rashidahussainb
RUclips: / @rashidahussain
Twitter: / rashidahussainb
#crispyfries #streetfood #frenchfries #rashidahussain #pakistanistreetfood
I am Brazilian and Greetings For Afeghanistan People ! 👏👏👏👏👏
Wow from Brazil! I'm glad to hear that. Thank you for your valuable comment 👍
Respect for all hardworking boys in Afghanistan.
Indeed! May Allah give him more success.
How about Mexico?
@@harukatakahashi8822fuck Mexico
This isn't Afghanistan I think it's Pakistan the language is Urdu the car look familiar just so you know I live in Pakistan
This kid is more grown than most grown folks nowadays 😒
I wish him the best in life. He has a good work ethic.
Yes! He is doing very well at this. May God grant him more success.
Thanks for the comment 👍
Ethic? Maybe. Hygiene is worse...
Who gives a shit he's just a 15 year old boy @@-Pawuloniasty-
Salute to this child😢
Yes! He is doing very well at this age.
That is what I call a hard working young man I give him all the respect keep going bro make your family proud
It’s a child and he should be in school
thats not a young man that is a child my friend.. why is he not in a school?
He has to be in the school. Not at work
This is all because of the corrupt countries that waged war in their countries, such as America, France and Russia. They are the cause of chaos everywhere
Haters
School makes you poor.
today is holiday...maybe part time job..take it easy,dude
Since you’re so concerned about his education, maybe you should put up the money to make sure that he gets proper education. Otherwise, he doesn’t need career advice from somebody farting behind the keyboard.
This Kid has got skills and talent, Insha-Allah when the boy grows up he Runs a successful Restaurant Business !! 😇👏🏽
Indeed! I hope so. May Allah grant him success.
Thank you for your valuable comment 👍
Haven’t got the skills of hygiene
@@TheJono1170 You can only comment but you Haven't got the skill of helping people
@@dreamzeroyt2180 how am I supposed the help this prick
Why saying Insha-Allah to an indian kid?
The container he is putting he fries in needs,a good scrubbing and never heard of putting flour on fries before. This young man knows what he's doing , hope he earns enough to help him and his family.
Yes! He half-fries some fries, so when it's rush hour, he fries them whole, so that saves him time and the customers. He adds corn flour to make the fries crispy. May Allah give him more success. Thanks for the comment 👍
WELL YOURE IGNORANT LOL
He adds corn flour to make it addictive and tasty so customers can come back all the time
Corn starch
Maybe not flour, but chipwhite.
Such a hardworking boy.
Yes! He is doing very well at this age.
He looks younger than 15... still, more power to him😊❤🎉❤ Blessings be😊
Yeah right! May God grant him more success.
Thank you for the comment 👍
etuivfdsdhjxnmmjvxsrteyiiiopufzsxmm🎉❤😢😢😢😮😮😅😅😊z fsdfvgb ..dgtrwesbhnhdszsfgghbn mxssddgtretyyuujolhssdffghhffffgv mmweewddgfhczxvbnmm🎉🎉🎉❤😢😢😮😮😅wrrrraaaaddffhghreeyynmkksaassdxxzzvvbbnn.mnsdghhjytewqqqwqassdfggfvxxvnnnvdazjnzxcvbbm🎉🎉❤😂🎉🎉🎉😢😢😮😮😮😅😅😊saddddddzghcxhhasxxcvvbddadrrrtyyyeeryuioadkjgfnn to wwqqssdasxxxdfggvbbxzmrhuujogfsghhjxc 2:29 vbnmrrretyaassdasqwwsddfgvzxcbn🎉🎉😢😢😮😮😅❤❤❤😂😂
xfgffv🎉🎉😢😢😮😮
Nice video. That’s really fun. Great cooking. Thank you for your sharing. Have a great day my friend
I'm glad you liked the video! Yes, he is doing very well at this age. Thank you for your valuable comment 👍
Definition of a true hustler 🔥🔥🔥💪🏻💪🏻💪🏻
美味しそうですね〜😋💕頑張って！
So proud of these hardworking dedicated people. God bless.
Wish all the best for him. He was literally better than me when i was the same his age. 👏🏻
went from 8 to 15 in 2 years .. amazing
what do you mean
Awesome talent ❤❤ done fullwatch your video. New friend here
The 10 year old kid has worked him self to the bone, working 25 houres a day the last 15 years. Amazing.
wow!!fantastic job ,hard working young man
The way he works is so efficient and got steady hands for such work and such his age
Yeah right! He is doing very well at this age. May God grant him more success. Thanks for the comment 👍
Strong hard working boy I hope he makes millions
Hope so! Thank you for the comment 👍
Economic Child Exploitation, a Child should be in School learning
@@DjWellDressedMan Lamentablemente no todos los niños tienen esa oportunidad
@@Smilemery like mexican kids
Good job kid . U selling food and always keep ur work station clean i love that !
Yummy! I love french fries! 🥲👍💯
🍔🤔🍟🍕😊🌮🍚🤗🥢🥱👛
8:50 I love it when y'all eating tha food! It makes me want to go travel there just to taste it yummy. Thanks you guys looks great keep up tha great work you guys.
Wow! I'm glad you liked it. Very welcome and must try it. Thank you for watching and valuable comment 😇👍
Enjoy your food poisoning
Bom dia,tiro o chapéu pra o menino, como ele é muito trabalhador e inteligente, ele faz serviço de adulto 😮
And our children are so lazy to wake up in the morning to go to school.. ☹️.. those childs like him are real human with strength. Big respect
Assalam u Alaikum bhai mai hamesha apki video sath jo add ate hey wo bhi dekhti hu Allah pak apko kamiyab karey Ameen
He has excellent work ethic he's an authentic young man.
He is a skilled child. God Bless him. 🙏🙏🙏
Best of luck to this kid. Hope he will succeed in life.
Nice sharing Vidio..very inspiring and creatif.. good luck.. masyallah 🇮🇩🌺🌼👍👍
flies included!
Kid works harder then most Americans i know. Myself included.
8:10 the taste test has a fly on it
He is a beautiful boy and champion😊
Yes! He is doing very well at this age. May God grant him more success.
Thanks for the comment 👍
🥰
0:12 His fast cut potato fries 🤔
God Bless this kid 🙏🥰❤️
Can we get a successful restaurant owner to notice him and maybe help him! May Allah bless him and his family.
Картошечка в условиях антисанитарии да на пальмовом масле, мм вкусно а!
Зато сколько приправы летает мясной =)
ماشاء الله تبارك الرحمن.. سيكبر رجلا حقيقيا
أسأل الله تعالى أن يوسع رزقه🇵🇸💚
🙏A.M.E.N🙏
Seeing how food in china is made im glad this people earn their pay with honest work
The way he working hard and motivated to his job I hope a good life for him I’m sure that will come fatser
Hope one day you will become a millionaire ❤
Billionaire, 😮😮😮lol😊❤🎉❤
Amazing Kid❤
..
Later will be success..❤
Yes! He is doing very well at this age.
InshaAllah! May God grant him more success.
This makes me value my job wish this kid the best
Very healthy environment for food making. 👍
LOL 😂
Allah pak hamarey pakistan ke halat achey kar dey Ameen
Our prayers are with you guys,insha Allah love from Kenya
Thank you so much
Hardworking boy...
My favourite food "Potato fries!"
Ese niño trabajando desde tan joven, será un hombre adulto de bien 😊👏
¡Sí! Le va muy bien a esta edad. Que Dios le conceda más éxitos. Gracias por mirar, estad atentos para más vídeos callejeros.
@@RashidaHussain
ииииииииииииииии
@@RashidaHussain sir I'm from India I want that potato cutting machine and we can make
o garoto trabalha honestamente desejo prosperidade para ele parabéns
Oh sim! Ele está indo muito bem nessa idade. Que Deus lhe dê mais sucesso. Obrigado pelo comentário.
Cool kid making some yummy fries
Чтобы картоха не чернела, это капец специи нужны, это есть нельзя!!!!
Hardworking and inspiring for others 😍
God bless the White man
very hardworking kid with crunchy and tasty fries keep up the good work son
Thanks dad
If that kids 15, I’m 65
One day he'll be a millionaire cause hardwork never waste. Love from India ❤🇮🇳
Blenchod, Hardwork is different from Smartwork.
Much love from Brazil
Einfach Klasse, dieser junge Mann hat eine große Zukunft vor sich. 👍❤️
great future yeah sure mate..😅
Frittenkoch... Herr Heise, zu mehr haben Sie es scheinbar auch nicht gebracht.
@@axjacobsen295keine ahnung wo ihr problem liegt aber ich habe keines. :) Überall auf der Welt werden Pommes verkauft, ist das jetzt was schlimmes?
Great future, ahahah
Hardworking is better than school 👺👍
Mashallah Allha Protect You Brother
QUE BUENO, LAS MOSCAS SON GRATIS
I pray whoever eyes catch this God give you the strength you need to overcome every battle your facing may the dark thoughts and overthinking,my be peace and calmness fill in your life🇧🇸❤️
8:10 i thought the fly was another ingredient 😅
Lovely ❤
French fries along with french flies 😂
Haters alert
Jealous mug
useless kid in the family, u only can ask money to ur parent, candy boys 😂
Come on guys he’s just adding some humor 😂
@@CALILIFE8251 lol
Full of respect for this young man... hard work and pasion make him rich some day, i hope for that ;)
I hope so! He is doing very well at this age. May God grant him more success. Thanks for the comment 👍
@@RashidaHussain welcome... Always I am full of respect for peoples who doing something good in their lives. In my opinion this boy is also a motivation for someone... Many thanks for this video
wow they look lovely
بسم الله ماشاء الله...دول اللى يعتمد عليهم
Антисанитария писец какая!!! Картоху с мухами я бы не стал пробовать
اللهم بارك للفتى ووسع له ابواب رزقك يا ارحم الراحمين تحياتي للباكستان 🇸🇦
و الله يقوي المسلمين. لتحرير الأماكن المقدسة للمنافقين الإسلام
The fries do look delicious 😋
Delícia batatas fritas, parabéns para o garotinho ele é muito habilidoso.🍟🍟🍟🍟😋👏👏👏🤗🇧🇷
Sim! Ele está muito bem nessa idade e deixa as batatas fritas saborosas. Obrigado pelo seu valioso comentário. Fique ligado para mais vídeos de rua.
Nunca vi tanta mosca....dá medo viu.
E porco tambem
@@alexmonteiro4267infelizmente lá é assim..
Vai comer, de lá vc não volta kkkkk
What is the white powder in the beginning?
This is corn flour.
I need one of these presses mounted in my kitchen lol
Work will set you free ❤
mmmm Flies with some Fry's! Double protein yummmy.. Keep up the work..
If he’s 15 than I was born on Mars
In my school back when I was 15, everyone looked younger for their ages for the most part.
It's not like in western countries where a 15 year old can look like someone in their early 20's.
GOOD WORK KEEP IT UP ❤
Keep Up The Good Work Brother 👍🏽
I will eat that..looks yummy..🤩
Too many flies
Someone buy the kid some fly zappers
Aku Saya Kamu Jinga Saya, um oi de parnaíba do sul, amamos seus conteúdo!!!! Arrasa mana.
Pakistanis are hard working. No wonder why they become successful when they come to the west .
The bugs buzzing around make it look much more appetizing!
es la cocina más limpia que veo de todos, el niño es muy sistemático y dedicado a lo que hace.
¡Sí claro! Le va muy bien a esta edad. Que Dios le conceda más éxitos. Gracias por mirar, estad atentos para más vídeos callejeros.
Está llena de moscas seas mamon
They're making French Fries. They are so yummy!
No, those are actually pancakes
They actually are not , hence why they are covering them in sauces
Amazing
This young chef boy is fascinating with his French Fries cooking, more later about his hardwork can relate on his own best.
Love from Philippines
Lies again? Driver Chauffeur USD SGD
Welldone he already know how to survive at young age
Yeah right! May God grant him more success.
Thanks for the comment 👍
Fries and flys
May Allah grant him prosperity. 🙏🏼
Still better than at Burger King, well done.
Love the Indians being frugal with their ingredients.
Nah burger king is better
He is not 15 years old! At least 12! Whats wrong with this country?! United nations prohibited child labor! What a shame! This child should go to school or learn something! Dislike as always
Haters alert
1) He looks about 15 to me because that's like the average 15 year old I seen everywhere even back in school. It's not like you even look older straight away.
2) We don't know if he works every day or not and not everyone in Pakistan can go to school due to a lack of money. If anything, this at least teaches him great skills in life.
3) Shut the hell up.
Education is a luxury when there's no food on the table. If he doesn't work they don't eat.
@@uqiesyukri7282chill kid
This Guy is amazing
Mashaallah❤
FRENCH FLIES
Yes! He makes it tasty with flavour spices.
Syf i bród nigdy bym tam nic nie zjadl😮
Exactly 😂
Nikt nie prosi cię o jedzenie. Frytki są czyste i pyszne. Muszą tylko posprzątać to miejsce.
@azunitedstates5615 No one is asking you to eat.
He's grown up❤