Of Choss and Lions ft. Alex Honnold and Cedar Wright | The North Face
HTML-код
- Опубликовано: 27 сен 2024
- Two of America’s boldest rock climbers Alex Honnold & Cedar Wright travel to Kenya’s Mt. Poi. The guys dodge choss, wild animals and general debauchery to claim ascents of Africa’s biggest big wall. Discover more: bit.ly/TheNorth...
Directed by Cedar Wright
Music Credits:
Remstunes
The Upsided
Michael Tomco
The Devil Whale
Alberta
Vekstar
Beta Radio
Val Emmich
Agrim Agadez
#NeverStopExploring
![Tee Grizzley - Blow for Blow (feat. J. Cole) [Official Video]](http://i.ytimg.com/vi/wNLN5xsx5dc/mqdefault.jpg)
"Cedar's climbing style is... he definitely doesn't over-think it." That sequence was gold.
I think I would even watch a 2 hour documentary about Cedar and Alex playing golf. This is amazing.
eew dnncbcm. MAspp is the time to bed c c a. , B.B. bol
M c
W A now w q
JJd c. Bojeywhqtyerjttyyrywuqvzcv hKlaksdufwiwiwowodhhhCc. )hvhhhgfffayytttrrrtrartsrawqqqqqersra
@@heathermay9629 you ok there?
They are a great pair haha
I’d pay to see that
"let's play golf, but first let's climb this wall shall we?"
"I mean... I think I'm ok..." *barfs*
Love Honnold
Hahahaha his fucking face while saying it too, lol
" If you gonna feel terrible, you may as well feel terrible while you tag the summit and be done with it."
badass
A los stupid cause that's how you die
I like that quote " pack a years worth of living into 3 weeks"
Cedar.... "luckily I have a Honnold on the rack."
Man this has to be my favorite climbing videos of all time. This is at least the 7th time I've watched it.
Exactly, I come back every once in a while to rewatch and it never gets old
"Your gonna want to drop knee the bush" That has to be the best single quote of any climbing video ever
I love when Alex is with his friends - he's so much more relaxed and no where near as awkward
nothing gives me more inspiration more than this stuff. I loved it.I don't even climb.
I've never climbed yet I'm obsessed with it all mountains are the earths pimples
"Luckily i have a Honnold on the rack"
Best quote
re-watching this after one year, it's still one of my favourite climbing/expedition films!
If Cedar and Alex had a baby, and that baby grew up, and that grown up baby was an animal, it would be my spirit animal
omg why do i keep seeing you guys everywhere i go
Cringe Climbing :
This 100% needs to be made into a series
"Even though a lot of the time i was like: I'm gonna f***in die, I'm so hot, I think I'm gonna throw up.. but it was a great day" LOL
Haha type 2 fun at its best
Always Enjoy Cedar and Alex together- would love more frequent updates even if just the more mundane things
Their reality show would be epic.
Absolutely! I would totally watch that!
"and so here we are" "Oh yeaaah"... Little nod to Sufferfest there?
Here we are
@@Mathuews1 o yaaaa
The part where cedar sends the roof almost made me cry of stoke
I'm so happy for these amazing people. They inspire me so much. I wish them a life time of beautiful moments. They deserve it all. Thanks for sharing you adventure with me!
"It's like the higher Honnold got, the worse it got."
Yep. That's how altitude sickness works.
I have decided my favourite climbing duo is Alex and Cedar!
12:49: "the fact is kept going, its pretty impressive and pretty dump" lol Cedar is so awesome. great sense of humor
You all make a great trio. I could've watched this all day..I love Africa.
This was GREAT! Love seeing him go down the easy way!
Getting anxiety just imagining being there, let alone the climbing part. They're for real hangin it out there, respect
Last song 13:46 "wooly mammoths-Val Emmich & The Veeries"
Chema Navarro YOURE A HERO
Cedar: So talk about how we got here.
Alex: Well, we flew on a plane...
Most Honnold answer there ever was. 😂
In my opiniom this is the best climbing video that exists
Cedar,always be the funniest guy
First off...was it a thorn or a hair?
Second...props to Cedar for sending that roof. That was dope!!!
Sitting here at my desk job in a tiny cubicle under fluorescent lighting thinking to myself, "That looks fun...."
this was really a masterpiece...but i'd love to see an extended version!!
This is defenitely one of the best things I watched lately
This is one of the best climbing films I've seen. Hilarious. Great job!
This is the best Video on RUclips ❤️
9:30 "Merry Christmas, i brought presents!!" *unceremoniously rips off a huge chossy flake* "WHOA!"
lol
"Luckily I have a honnold on the rack" most legendary line ever
The best medicine is laughter, and being able to laugh at one's self when faced with adversity is the best medicine of all. Great film and a fine adventure!
David Hardaker
THIS IS FREAKING UNREAL!!
😫😫😥👺💦💧👊👎
Scrivscribe xx
C
Hdfztupcuyxodkhxtjxjg bkvj ig jb ig chhfdhztu😴💔😴😴💔😈😈😈😈😈😈😆😄😃🤤😃😇😆🙂😆🙂👌🏼😁😁🙂😆😆🙂😄😆🤣😁😁😂🙂😄🤤🙂😆😃🤤😃😅🎂🎂🎂🎂🎂🎂😴😴😴😴😗🎭🎷🎼🎨🎨🎨🎤🎤🎤🎤🎤⚔️⚗️💣🔫🔫💣🔫⚔️⛓🔫🔫🔫🔫🔫🔫🔫🛡🔫🔫🔫🔫🔫🔫🔫🔫🔫💣🔫🔫💣💣💣💣🔫🔫🔫🔫🔫🔫🔫⚗️⚔️💣🍅🐑🐓🐩🐩🐩🕊🐎🐩🐫🐅🐖🐆🐕🐖🐎🐏🐖🐩🐇🐎🐎🐫🐎🐎🕊🐪🐫🐪🦓🐩🐑🐇🦓🐩🐂🦓🐏🐳🐖🐙🦍🐾🎩👒👝👒🐧👑👓🐕🐏👑🐖🐙⚔️🐖👑🥕🍫🚒🎯🚝🚈🚈🚉🚅🚈🚝the jione huhin be I lmlnoml
Kmknbj bi hi obj oh no ihvu🤦♂️
Mb oh bulbul was the time to
Cedar and Alex have comedy team timing.
sooooo cool, so grateful I could meet these awesome guys. maybe ill climb with them some day... maybe...
Just watching this hurts my stomach. These guys are crazy but damn amazing
Amazing! A side of Kenya very few have ever seen! Great video and well done all!
Cedar Wright is so cool
This was awesome 😂 Turns out Cedar and I have the same climbing style! Lmao
Your humility precedes you Alex. I wish I were more like you. Stay calm and humble. And alive.
The North Face brings me more Alex Honnold videos than Reel Rock.
Translation: I love you!
"It's like the higher Honnold got the worse it got."
Well, yeah, what did you expect from altitude sickness?
i could watch this stuff for hours and hours...the timberlake and fallon of climbing.
I love feeling pure when I climb. I love climbing without a helmet on clean sport routes. But dude, how do you not worry about your belayer getting knocked out cold when you're way up on lead, trundling boulders off the cliff on the first ascent?
This film inspired me to be more like Honnold so today I got a headache and laid down for a little while.
What beautiful bunch of people you are , I admire your guts 🙏🙏
Honnold is the best. ❤️
Go Bernie Go...... Go Bernie Go..... Goooooo Bernie!!!! 🐶
that is so inspiring,, love these handsome guys)))
Amazing. I hope someday I'll be able to make those ascents and travels!
Cheers guys! U rock!
They already have what they need. After the previous generations of exploding alpine egos it is an understatement to say that it is refreshing to hear such accomplished practitioners declare, “climbing means nothing” and to put some of their earnings from it into projects to support the bypassed and left behind that we are generating in such an abundance. Cedar Wright actually is an artist with a substantial gift and the charm of his stories is his unvarnished authenticity. Not it’s tailored image. He achieves formal aesthetic master strokes into the bargain and the editing demonstrates that he knows how to recognize them, so they are not entirely the manifest of happy accidents, which he also deserves and probably enjoys with some confidence of regularity. I don’t know. Now I am speculating about karma.
I've watched this like 5 times. Thank you.
ya that was leave no trace for sure...
Lost it at "you're gonna want to drop-knee the bush"
Lots of worry. Nothing to loose
"its pretty mega looking" lol i love alex honnold
Such a nicely made movie!!
Genuine LOL moments. Thanks guys💗 . Combo goodness. ☺
So glad Cedar got the sky crack like many of us! :D
Cedars climbing style “he doesn’t overthink it” these guys clown on each other so hard 😝 bet they sing the three best friend song from the hangover 😝
I did it. Yay.
Classic Alex
i don't believe cedar when he says he'd miss a day of climbing if he got sick
song at 7:04: is proving ground from alberta & the dead eyes
I wouldn't be surprised if next they started a platinum selling band and then became astronauts.
This video wins the award for WORST thumbnail on RUclips
what are you talking about, it's glorious.
You need a metallurgist to inspect your anchors for material grade and defects!
these guys are such badasses
Funny Cedar. Hey at 1:27 the guy is wearing my old 82nd airborne uniform
Holy shit, 10:20 is gold. This man kicked into super strength.
recently read No picnic on mount Kenya so the final 5 minutes was a pleasant surprise
Sounded like cedar was blowing smoke
Nice to know I’m not the only one who calls it “the bush”
Come to Golden BA Canada for great climbing spots see you soon
RUclips thank you for recommending this...... you r starting to know me...
Awesome and hilarious adventure!!!
This made my day.
I hope you guys had some delicious coffee there, Kenya has some of the best coffee in the world!
Such a crush on Maury. :) Great video, guys!
Alex is such a goof, “haha you fell in thorns.”
man that video just got me so psyched to get out there. develop!! dirty but rewarding work
Really enjoyed this video!
Loved it! Great work TNF
This is the only video where I can say and I can write that it is the greatest, funniest as fucking shit, and beautiful of all, ever.
10:34 ah ah.Suddenly WOW WOW!
"It's pretty Indiana Jones-ey"😉
you guys are nuts and I love you haha
This is SO Classic!
Awesome
God I hope to be able to be like him one day and just climb I want to love breath and eat climbing it's all I think about and do
That was awesome!
This is one of the best movies/features I've watched. I would have loved for it to have been a lot longer. :D
10:40! Yes!
Inspiring that next epic with your bros
dude sick video