9 years ago..we were teenagers watching this from all over the world. Time flies, the old good songs remain. I am not a teenager anymore and I don’t have fantasies of life. This video brings about lots of nostalgia to my naive innocent self.
This was the fourth film of Katrina Kaif which she carried on her own shoulders and made it a superhit after Namaste London,newyork,ajab prem ki gazab kahani and raajneeti that's how Bollywood got it's first biggest female superstar she was the very first Actress of the 2000s generation who gave back to back Superhits without any big star(though in the films with khans she shines as equally as them)as the male lead,this is the power of an outsider🔥biggest female Superstar of India for a reason
@Urban Legends salman toh kitno ko le kar aaya h or abhi lata h lekin koi chalti bhi hai... Hard work bhi kuchh hota Sonakshi Sinha, zareen Khan, or bhi bahut h
So far Katrina has done only one film in her entire career where she was the center of everything. And God! What a performance she gave! From acting to facial expressions and dance everything was perfect!!! One of her usp orher than her attractive face and killer abs is her comedy skills. Wish she had done more of such roles.
She did so many which she has more time in the movie than the lead actor gonna recommend you some check and watch she truly killed it so many solo movies praised and win so many awards baar baar dekho , fitoor , ajab prem ki ghazab kahani, jagga jasos, raajneti, zindagi na milegi dabora , phantom New York ,apne, flying fairy until liffery , jewel of india, sarkar, main krishna hoon!! Truly the best
@@samiirababe7054 Yes she did a lot of other worth mentioning roles, and I know she performed extremely well in some of those and that's why I think she deserves to be in lead roles. There is a rumour she is going to be a female Super hero in her next, hope this is true.
dear Noha Fatehi,only Katrina can bring down the entire house..........i still do remember how crowd went berserk on katrina's arrival......sensational....
Nora isn't just a Bollywood actress like Kat, she's international artist who even got featured in FIFA world cup anthem where kat can never reach. Period!
Whenever I listen to these songs I realise that those were the old good days listening these songs on bindass and 9Xm . So many years have passed but these songs are still unmatchable to present party songs which are rubbish
@@idkwhattonamemyself9326 seriously means !!! Sridevi , Madhuri Dixit, Aishwarya Rai, Deepika Padukone and Priyanka Chopra are internationally famous and talented than katrina !!
I used to listen this song in std 3 and till now this song has the same magic. Meanwhile Ali Zafar's facial expressions are lit 😂🔥better than Ajrun Kapoor's whole career.
Kat is full on fire 🔥 in this song..I mean look at her grace her charm her dance moves..everything is perfect💯 no wonder she is childhood crush of every 90s kid😍
Katrina's entry stole the show , her priceless expressions , sharp facial features , sparkling smile , fab steps and wonderful figure ... And most importantly her acting in this film would make anyone drool over het
What I love about this song is that when one person is lipsing, there's one vocal, and there are multiple vocals when multiple people are "singing". Many movies forget this part
nobody could dance properly except Katrina . she is flawless and impeccable as always . even the girl in black was literally struggling to do the steps
@@mouzemasood I m not hyping anyone .. the black dress girl was trying too hard and was awkward with all the steps ...katrina did it effortlessly and with much grace
The only reason I always come back to watch this song is to see Kat's moves & her insane figure, & I'm a straight female. There's no one quite like her 🔥
I literally got goosebumps while hearing this version ! At first I used to sing the "mere dholna love version" but now I could feel the pain and hate in these lyrics I just love it ❤️
When Katrina arrives with the lines "Taj-o-takht mai to laakhon gira doon" I m like damn she is freaking right.
😂
Aunty u r right🤩🤩
The fact the even girls go crazy over Katrina imagine...what happens to us boys 😁😭😍
Please translate for the non hindi speakers please
Translate pls I don’t understand but I enjoy sm
I still remember how crowd went out of control on Katrina's arrival. Theater was literally on fire 🔥 still love this song.
Jo
Koi🎉🎉😮
, i%😮@@IMI660
00afscfdxgdchfchgbhvhfchfcjfcjfcjgwetrdftdtryrgytrdhtefdyeyrdyyedueusgdvhdxchgcjhfvjgvnhhbjhnkhbmjgbwertrytrgytytrhyttyrgyrdgyyrgyrguryssgdchfchfhyyrcyfhhrchtdchhfcbydc
1234567890,.
The heart of this song 2:28 ❤🔥
Katrinas entry in this song is on fire 🔥. One can judge her acting but no one is better dancer in Bollywood like her❤
Right ❤
00sfdxfdcggdcgcfdcgfchgcvhfcvnjnwetrftedfyestdrrtrstyrsfurdyredtesuesgdcgdxgfxchfvhfchcbhhjgbnjgbjgvkwetedfteyetedyreftedtedtestedytddysgstsxfsxchfxvhfvhbhjgbjgnjgbkhv
Katrina entry 😍 2:22 gives me goosebumps
Same ❤❤❤
9 years ago..we were teenagers watching this from all over the world. Time flies, the old good songs remain. I am not a teenager anymore and I don’t have fantasies of life. This video brings about lots of nostalgia to my naive innocent self.
I watch this movie year of 2
I watched this when I was 16.. In 10th standard..
Now I'm 28.. Those days can never come back😩
damn man who hurt u :')
Ç
She's something
You can't ignore her..
People still use her name katrina kaif as a compliment
💕
true
Yesss
I like KK
Truee
Katrina is so stylish sizzling actress ❤🔥
Imran may not be so much successful in his career,but he is an important part of our teenage pop culture
Absolutely true❤️
Actually
True
Kya pop bhai?
Indian pop died a long ago.
It waz the era of Kata laga, Chadti jawani, Rangeela re, Rakhi sawant, Deepal shaw etc.
💚🌍😓👀💝👈👊
Unpopular opinion : Imran Khan has the most underrated songs🔥
Agreed.
He himself is sooo underrated.
Having 6.2 crore views isn't underrated
NAWRIN yess
Not at all underrated, not all songs of Imran Khan are good
God I remember when Katrina's entrance came and everyone in the theatre lost it. Good Times ❤️
Was everyone cheering and dancing w her?
that entrance was really stunning of katrina even the starting entrance of tara d souza🙂🙂
Really yaar
@@harrymittal590 fabulous song from light hearted fabulous movie brings back the old memories of 2011🙂🙂
SHE IS THE QUEEN😍
Life was good, when Imraan khan used to do movies
I watched this movie in Theatre
And I still remember the whistles and the applause on katrina's entry during this song
There is no God except Allah, prophet Muhammad is the messenger of Allah ❤️🌸
قال الله تعالى : ( وَقَالُوا اتَّخَذَ الرَّحْمَنُ وَلَدًا (88) لَقَدْ جِئْتُمْ شَيْئًا إِدًّا (89) تَكَادُ السَّمَاوَاتُ يَتَفَطَّرْنَ مِنْهُ وَتَنْشَقُّ الْأَرْضُ وَتَخِرُّ الْجِبَالُ هَدًّا (90) أَنْ دَعَوْا لِلرَّحْمَنِ وَلَدًا (91) وَمَا يَنْبَغِي لِلرَّحْمَنِ أَنْ يَتَّخِذَ وَلَدًا (92) إِنْ كُلُّ مَنْ فِي السَّمَاوَاتِ وَالْأَرْضِ إِلَّا آتِي الرَّحْمَنِ عَبْدًا (93) لَقَدْ أَحْصَاهُمْ وَعَدَّهُمْ عَدًّا (94) وَكُلُّهُمْ آتِيهِ يَوْمَ الْقِيَامَةِ فَرْدًا (95))
Me too
Jai shree ram
0
@@stephanie9499bro stfu first show me allahs pic
Is film ki teen cheeze acchi hai....
Katrina
Imran's chequered shirts
Ali Zafar's hairstyle.......too good
Aur story bhi
Puri movie epic h
Ali Zafar's reaction❤️ when he was with Katrina ❤️😍
I think their chemistry more strong than Katrina-Imran's chemistry. They should to had others movie
@@vullsuniehe is haresser im real life
As soon as Katrina enters you know that all the spotlight will go towards her...Absolutely stunning and gorgeous...Best Dancer in the industry !!!
2:17 katrinaaaa😘😘😘
This was the fourth film of Katrina Kaif which she carried on her own shoulders and made it a superhit after Namaste London,newyork,ajab prem ki gazab kahani and raajneeti that's how Bollywood got it's first biggest female superstar she was the very first Actress of the 2000s generation who gave back to back Superhits without any big star(though in the films with khans she shines as equally as them)as the male lead,this is the power of an outsider🔥biggest female Superstar of India for a reason
@Urban Legends just shut up...she is the biggest female superstar of bollywood...she is an awesome actress
@Urban Legends i hope u don't know the meaning of hardwork thats why u are saying this
@Urban Legends salman toh kitno ko le kar aaya h or abhi lata h lekin koi chalti bhi hai... Hard work bhi kuchh hota Sonakshi Sinha, zareen Khan, or bhi bahut h
Indeed a superstar but sorry a really bad actor
@@BADBOYGAMING715 aur Katrina ko toh usne nahi laaya Katrina ne toh boom,sarkar se dubut kiya ayesha shroff launched her
She didn't born in India....but she learnt the dance forms and improved herself. Everything is so perfect about her❤️
She is Half Indian
Now she is full Indian 🤞
@@azmatfuzail3307 how
@@yaseminyesil4985 cz she Married in India with Indian Bollywood actor Vicky kaushal
@@azmatfuzail3307 Unless she is an Indian citizen, she isn't Indian.
Anyone in 2025
Me
Yes I am 😊😊
Me😊
Me after long time
Yes 😂❤
Katrina's Entry in the Song is after 2 min but mahn! Her Entry itself Stole the whole song,, Katrina Always Naileddd itttt😍😍💥💥
Sahi baat
There is no God except Allah, prophet Muhammad is the messenger of Allah ❤️🌸
قال الله تعالى : ( وَقَالُوا اتَّخَذَ الرَّحْمَنُ وَلَدًا (88) لَقَدْ جِئْتُمْ شَيْئًا إِدًّا (89) تَكَادُ السَّمَاوَاتُ يَتَفَطَّرْنَ مِنْهُ وَتَنْشَقُّ الْأَرْضُ وَتَخِرُّ الْجِبَالُ هَدًّا (90) أَنْ دَعَوْا لِلرَّحْمَنِ وَلَدًا (91) وَمَا يَنْبَغِي لِلرَّحْمَنِ أَنْ يَتَّخِذَ وَلَدًا (92) إِنْ كُلُّ مَنْ فِي السَّمَاوَاتِ وَالْأَرْضِ إِلَّا آتِي الرَّحْمَنِ عَبْدًا (93) لَقَدْ أَحْصَاهُمْ وَعَدَّهُمْ عَدًّا (94) وَكُلُّهُمْ آتِيهِ يَوْمَ الْقِيَامَةِ فَرْدًا (95)).
People now: NORA NORA
But When Kat enters 🔥🔥🔥🔥
Thanks for likes guys
Katrina is a queen who is not comporable with anyone
Guys buy nora bhi sahi dance karti hai
@@zubersyyad7650 Aw wanna cry ? coz kat is the queen
@@Harsheyyy173 Nora ko mention hi kyu Kar rahe ho, Praise your queen without dragging her, 😂😂😂😂,
@@KarinabiasedMyyou mean effort of nora yah Right what a Drag 😂
2:43 lines 🔥
Both girls are very stunning i can really fall for them
Can we take a moment to appreciate Ali's expression at 3:46?????
He's damn good looking 👌
Yes💖
Chii
Soorbhi,we can not appreciate this jack ass singing.
🤨lit🔥🔥🔥
Katrina is just unreal, such a gem 🤩. The song still sounds so fresh
So far Katrina has done only one film in her entire career where she was the center of everything. And God! What a performance she gave! From acting to facial expressions and dance everything was perfect!!! One of her usp orher than her attractive face and killer abs is her comedy skills. Wish she had done more of such roles.
She did so many which she has more time in the movie than the lead actor gonna recommend you some check and watch she truly killed it so many solo movies praised and win so many awards baar baar dekho , fitoor , ajab prem ki ghazab kahani, jagga jasos, raajneti, zindagi na milegi dabora , phantom New York ,apne, flying fairy until liffery , jewel of india, sarkar, main krishna hoon!! Truly the best
@@samiirababe7054 Yes she did a lot of other worth mentioning roles, and I know she performed extremely well in some of those and that's why I think she deserves to be in lead roles. There is a rumour she is going to be a female Super hero in her next, hope this is true.
@@masudtazrian6791 it's confirmed on her birthday will be made a budget of 200cr
Her acting in jagga jasoos, tiger zinda hai, zero etc was perfect
She was so amazing in Zero, Bharat, and Tiger Zinda Hai too. I also love her in Baar Baar Dekho, Namastey London, and Ek Tha Tiger.
Any One.. in....2024🤔🤟🏻
Such A Beautiful track💯✨
Me
Me❤
Good night 😢🎉😂❤😊
Me
Here
dear Noha Fatehi,only Katrina can bring down the entire house..........i still do remember how crowd went berserk on katrina's arrival......sensational....
You are just insulting katrina indirectly by comparing her with nora
@@dhruvpachauri1739 correct.I respect Nora but she can't create a magic like katrina in any song.Kat is kat.
Kat less expression
Nora isn't just a Bollywood actress like Kat, she's international artist who even got featured in FIFA world cup anthem where kat can never reach. Period!
Kat ruled that era, Nora is ruling this era, have you ever been to theatre to see the reaction of crowd during Nora's dance?!
Its insane
2:22 katrina🔥🔥🔥
From the time when bollywood had original songs... Not remix.. 🙂
This comment deserves all the likes
Yes
Absolutely right
❤💕
Yyeeeeppp
This is still katrina's best performance in a movie. She was just so natural in here..
Whenever I listen to these songs I realise that those were the old good days listening these songs on bindass and 9Xm . So many years have passed but these songs are still unmatchable to present party songs which are rubbish
How old are you?
present party songs aren't rubbish. they are based on rap trend which we aren't much interested in. they are just different.
@@nikidon99 Why are you asking her age?
@@anildhakne3417 she said good old days
@@nikidon99 1995-2000 born has other feelings which post 2001 generation won't understand
Don't worry we'll meet again after 10 years in comment section while listening to this gem 💎♥️🎶🥳
Might be
God bless us ❤️✨
Yess its true ♥️
Love u
God bless u dear
Promise
4:34 ali's reaction 😂😂
No one can match Katrina energy level.. shes just mind blowing..
Then u don't know Madhuri Dixit, Aishwarya Rai, Sri Devi , Priyanka Chopra , Deepika Padukone , Nora Fatehi 😂
@@ruturajshirke1604 they're trash infront of katrina
@@idkwhattonamemyself9326 seriously means !!! Sridevi , Madhuri Dixit, Aishwarya Rai, Deepika Padukone and Priyanka Chopra are internationally famous and talented than katrina !!
@@ruturajshirke1604 kat is now the biggest female superstar of bollywood and u are just a hater and andhabhagat
Yess ❤️ & kids these days compares Noora with kat
When katrina enters the scene, it hits differently, man. 😍
Where?
Right ❤
4:52 fav part ❤
Kon kon meri tarah raat ke 3:30 baje ye song sun rha he 😅😅😅😅
Bhai 3:48
3:17 !!
Mai 😊
😂😂 me at 3:16 am
4:15 😂😂😂😂lol
I used to listen this song in std 3 and till now this song has the same magic. Meanwhile Ali Zafar's facial expressions are lit 😂🔥better than Ajrun Kapoor's whole career.
😂i was in 3rd too
I was also in 3rd standard at that time
I was also in 3rd🖖
J
😂😂😂
Kat is full on fire 🔥 in this song..I mean look at her grace her charm her dance moves..everything is perfect💯 no wonder she is childhood crush of every 90s kid😍
2000s 😍
2:18 katrina expression 😍
Unpopular opinion but Ali Zafar and Katrina's chemistry was also top notch🔥ig we need another movie of theirs together 😩❤
1990-2014 the golden time for bollywood music industry...
Romantic songs, party songs , emotional song all were hits..
I still remember when I used to miss school I watch these songs on 9xm zoom mtv n other song channels since morning only...
Haa ❤❤bhai
Bilkul 💯😊
@@truffles5854 same
Yes after 2014
Everything seemed changed
Miss those days
Only 2000s kids will understand the magic of this song😭❤️
acha
Ikr🤧💗
2002 ❤️
2005 ❤
Bro hm 90s wale is song k tym pe teenage the 7th 8th cls me the 😂 90s kids will also understand
Katrina's entry stole the show , her priceless expressions , sharp facial features , sparkling smile , fab steps and wonderful figure ... And most importantly her acting in this film would make anyone drool over het
90's song with amazing video
ruclips.net/video/Tdixc_lV02k/видео.html
Sorry.. But she is perfect in everything but not in acting
Overrating 🥴🤔
Expressions ?
@@pragati9379 can't agree more perfect💯✨ reply katrina is not a bad actress
Literally noone is like Katrina Kaif one can judge her by her acting but in dance nobody can even come close to her ❤
Katrina's expression at 2:17 is everything
❤
So true💯💯
3:15 killing me every. single. time...
Same😂
the girl in black is very beautiful.
realy....
hmm
Sona no
bahut pyara song hai
Ria Yes but Kat is more beautiful
Anyone December 2024
May dekh rahi hu😊
Yes
Yaaa
M bhi dekh rahi hu 10 pm
😂yes
I had a major crush on Ali zafar as a teen, just because of the way he speaks❤
Same with me 💕
Same here 😀😀
Same 😂😂
I always didn't like him because of the way he speaks
me too
3:07 When i was a kid i used to sing that line "teri tareefe karta mohalla re" as "teri dhadi( beard) se darr ta mohalla re"
😂😂😂😂
😂😂😂😂 OMG LOL
Abe dari bolte hai dadi nhi dadi grandmother ko bolte hai
Hahahahaajahahah
😂😂😂
This song is a treat for the eyes..Katrina + Ali =✨
Ali is so talented😎
There is no God except Allah, prophet Muhammad is the messenger of Allah ❤️🌸
قال الله تعالى : ( وَقَالُوا اتَّخَذَ الرَّحْمَنُ وَلَدًا (88) لَقَدْ جِئْتُمْ شَيْئًا إِدًّا (89) تَكَادُ السَّمَاوَاتُ يَتَفَطَّرْنَ مِنْهُ وَتَنْشَقُّ الْأَرْضُ وَتَخِرُّ الْجِبَالُ هَدًّا (90) أَنْ دَعَوْا لِلرَّحْمَنِ وَلَدًا (91) وَمَا يَنْبَغِي لِلرَّحْمَنِ أَنْ يَتَّخِذَ وَلَدًا (92) إِنْ كُلُّ مَنْ فِي السَّمَاوَاتِ وَالْأَرْضِ إِلَّا آتِي الرَّحْمَنِ عَبْدًا (93) لَقَدْ أَحْصَاهُمْ وَعَدَّهُمْ عَدًّا (94) وَكُلُّهُمْ آتِيهِ يَوْمَ الْقِيَامَةِ فَرْدًا (95))
Pahli baar suna yaar ✨❤️🔥🥀😀🔥❣️👌👌
*This song never gets old. No matter how much I listen to it, I never get bored.*
What I love about this song is that when one person is lipsing, there's one vocal, and there are multiple vocals when multiple people are "singing". Many movies forget this part
Ali Zafar's reactions are priceless! 😂😂
EpicMiBz!! km
He is an underrated actor.
Divyanshu Rai pjs
Hello
Hello my
@@nitolkundu5966 kyu ki vo pakistani hai
Hio
عشقي هالاغنيه 2024/11/10
this song is the most underrated song in Indian music history.
1:56 *His reaction is like: Nothing happened baby. It's okay. Cool.* 🤭🤭😂😂
This song never gets old,the voice of the female singer is fantastic 🙂
Ali zafar uff ❤️
the theatre had became a cricket stadium on Katrina's entry
2:22 Princess ki entry to dekho😯
Katrina's expression at 2:18 is striking. Still remember it to this day.
Who is listening this song in August 2020......
Bhai🙌🙌🙌
meeeeee
I m here 🤘🤘🤘🤘
Binod
I
Khali gaya na tera vaar. Kat ur just do dhaari talwar yaar.❤❤🔥🔥
Today's songs can never beat the masterpieces made in 2000s
Listening in quarantine time🥱🤩
julie khan Me too
Yo también
Denniz Lk ?
Denniz Lk haha yeh me too! Do you like the song?😀
@@shellysharma8784 I love this song
Yo amo esta cancion
4:11 the man next to zafar is looking like sins 😅😂😂
2:23 my most fav part Katrina 🥵❤
Kat & Ali has really a good chemistry together.. they look stunning @4:22 when she was in his arms..
Who else thinks the same?
Exactly 🥹
2:28 Aren't these the perfect lyrics for Katrina to dance on?
nobody could dance properly except Katrina . she is flawless and impeccable as always . even the girl in black was literally struggling to do the steps
Cdnfdkgekrgfdjfrkgrjfegfeofejkfekerjfrhfeofdgshgegrfekgwbkgrkbjbk eerya
Thats so not true. As good at kat is that girl in black was doing a much better job. She was dancing flawlessly. Dont hate on others to hype others
@@mouzemasood he ain't hyping anything.
What he said is the fact. Accept it.
90's song with amazing video
ruclips.net/video/Tdixc_lV02k/видео.html
@@mouzemasood I m not hyping anyone .. the black dress girl was trying too hard and was awkward with all the steps ...katrina did it effortlessly and with much grace
احلى فلم 🇮🇶🇮🇶🇮🇶🇮🇶🇮🇶🇮🇶🇮🇶🇮🇶🇮🇶🇮🇶🇮🇶🇮🇶🇮🇶🇮🇶🇮🇶🇮🇶🇮🇶🇮🇶🇮🇶❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤
04:34 ali and imran's eye contact 😂
My all time favourite song & movie. OMG katrina's entry in this song has won so many hearts . She killed this song with her expressions.
🥵🎂
2:17 Katrina’s expression 👌
Who’s here after watching amazing dance on this song by Dananeer Hania & yashma 🙋♀️
The make up of Katrina was done by herself 😍 🥰
1:36 Ali expressions🤣😂
4:22 Unpopular opinion: Ali & Kat could make an unbeatable couple ♡
don't know about the movie, but this song definitely needs a re-release in the theatres ❤🔥
The only reason I always come back to watch this song is to see Kat's moves & her insane figure, & I'm a straight female. There's no one quite like her
🔥
Same here dude..m also big fan of kat from childhood n till now
Shahid Mallya's voice is on another level ❤️ we listen to so many songs sung by him without even realising that it's his song
Katrina's Era and our Age of innocense.❤️>>> Valuable than any other life's stage.
Still I have huge crush in her, She is gorgeous and intellectual!.
I literally got goosebumps while hearing this version !
At first I used to sing the "mere dholna love version" but now I could feel the pain and hate in these lyrics I just love it ❤️
Katrina Kaif is still magic as she was before ❤
4:19 dancing dancing 😂😂
Dencing dencing😂😂😂😂😂😂
1:57 Loved this sequence... Perfectly choreographed with respect to lyrics... 😍
Anyone in December 2024
Katrina was and still the most beautiful and talented girl I've ever known ❤️
In this song Katrina's entry just fire.....damn...😍😍😍😍
Agree🙈🔥🔥
Akdam hot 😍😍
❤️❤️
@@humairarehman23 y
E
This was the golden era of bollywood
Imran and Ali zafar 💜
Sdzsddd
Anyone 2025?
I am a big fan of Katrina 's entrance in the song ..It is mesmerising with the base in the song ..It is such a wonderful party song ❤️❤️Addicted!!
There is no God except Allah, prophet Muhammad is the messenger of Allah ❤️🌸
قال الله تعالى : ( وَقَالُوا اتَّخَذَ الرَّحْمَنُ وَلَدًا (88) لَقَدْ جِئْتُمْ شَيْئًا إِدًّا (89) تَكَادُ السَّمَاوَاتُ يَتَفَطَّرْنَ مِنْهُ وَتَنْشَقُّ الْأَرْضُ وَتَخِرُّ الْجِبَالُ هَدًّا (90) أَنْ دَعَوْا لِلرَّحْمَنِ وَلَدًا (91) وَمَا يَنْبَغِي لِلرَّحْمَنِ أَنْ يَتَّخِذَ وَلَدًا (92) إِنْ كُلُّ مَنْ فِي السَّمَاوَاتِ وَالْأَرْضِ إِلَّا آتِي الرَّحْمَنِ عَبْدًا (93) لَقَدْ أَحْصَاهُمْ وَعَدَّهُمْ عَدًّا (94) وَكُلُّهُمْ آتِيهِ يَوْمَ الْقِيَامَةِ فَرْدًا (95))
@@stephanie9499 🤣🤣🤣🤣🤣
We danced on Dhunki at our college fresher's party performance
i cant take my eyes on katreena she is just awesome and this movie makes beautiful memory to me those days are awesome
4:22 - 4:35 can't take my eyes from ali zafar....😍😍😍😍😍
Same here
Me 2
Saaaaame ❤
Bahahaha, cause he looks stunning 😍
Yesss djdhjdhdhdhdhdrbhf 💘💘
Morning 🎉🎉.. 0:15