Your positive comments motivates me. Teachers like me just wants positive comment from student. Love from you guys means a lot to me. My goal is to create largest community of engineers in entire globe. Please help me by sharing this playlist with your friends.
Your Appreciations, care and share matters a lot to me. #EnginneringLove. All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us. Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
Your Appreciations, care and share matters a lot to me. #EnginneringLove. All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us. Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
Thank you so much doctor for your valuable efforts. I have two questions I hope you reply it. Q1) Is QPSK the same PSK that has L= 4 ? Q2) DPSK is convert the signal from digital to analog or not?
Your Appreciations, care and share matters a lot to me. #EnginneringLove. All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us. Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
Your Appreciations, care and share matters a lot to me. #EnginneringLove. All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us. Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us. Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
This video is overall an OK explanation of QPSK but it is missing an important piece of information, which is that the bit splitter is also an NRZ encoder. This confused me and I thought that the BPSK Q and I signals were multiplied by 0 and 1, rather than +1 and -1.
Your Appreciations, care and share matters a lot to me. #EnginneringLove. All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us. Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us. Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
Your positive comments motivates me, my goal is to create largest community of engineers in entire globe, so please help me for that by sharing this lecture series(playlist) with your friends in social media (watsapp, telegram etc). Thanks and welcome 🙏
All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us. Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
Your positive comments motivates me, my goal is to create largest community of engineers in entire globe, so please help me for that. Thanks and welcome 🙏
Your positive comments motivates me. Teachers like me just wants positive comment from student. Love from you guys means a lot to me. My goal is to create largest community of engineers in entire globe. Please help me by sharing this playlist with your friends.
@@EngineeringFunda Sir, on 28 December I Had a GTU Exam of 5th Semester of VLSI Subject and this QPSK Modulator is for 7 Marks and this Videos help me lot of.... Thank you Sir 😊
Your Appreciations, care and share matters a lot to me. #EnginneringLove. All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us. Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
I have a multiple choice question: A signal 2-ASK with data [1001] and with an initial phase of 0 degrees added with a signal 2-ASK with data and with an initial phase of 180 degrees, the result of the summing would be: A)Signal FSK B)Signal BPSK C)Signal QPSK D)Signal 4-ASK Can you help me please because a have a test
@@sabinshrestha7196 because in first we have to do modulation but here we are doing demodulation that is the opposite of modulation so here we connect opposite Got it ?
Could you do in multisim modulation and demodulation QPSK i would like to learn how to make it with all the math that i need fb... B... Etc because i know the theory but idk how to make in practice
Your positive comments motivates me. Teachers like me just wants positive comment from student. Love from you guys means a lot to me. My goal is to create largest community of engineers in entire globe. Please help me by sharing this playlist with your friends.
Your positive comments motivates me. Teachers like me just wants positive comment from student. Love from you guys means a lot to me. My goal is to create largest community of engineers in entire globe. Please help me by sharing this playlist with your friends.
Sir u should have shown even bits waveform and odd bits waveform before drawing QPSK o/p waveform because i had referred your notes only. And today in exam i did the same what u have told in this video but i didn't take even&odd bits waveform.I thought that we should take pair of bits in a given sequence.🤦 i m gonna loss my marks😔😥
I dnt know why but sir ke lecture aadhe lagte hai .... aisa lagta hai he is trying to explain the stuff but at the same time missing something .... complete clarity ni ho pati topic ki.... plzz sir ispe work kariye ... Har ek part ko achche se bataiye .... Samjhne me dikat hoti hai.... itz a humble request ..... koi bhi topic pe according to syllabus complete vedios banaiye plzzz
A serious feedback is sir please dont put advertisement in the middle of the video whole concentration gets disturbed and frequency of advertisment is very high i think their are at least 5 ads in single video ............when their were any advertisement i was like change this video
*🔥All Premium Courses Link of Engineering Funda🔥*
docs.google.com/spreadsheets/d/1LeLxZPGiMB_ZDZggbZp3P7fK516pXYhVgZA__djNkWM/edit#gid=0
00 is 0⁰
01 is 90⁰
10 is 180⁰
11 is 270⁰
Very Clearly and from zero level explained
Your positive comments motivates me.
Teachers like me just wants positive comment from student.
Love from you guys means a lot to me.
My goal is to create largest community of engineers in entire globe. Please help me by sharing this playlist with your friends.
Sir please explain
What is the full form of BPSK-I and BPSK-Q???
the phases for QPSK are 45, 135, 225 and 315 instead of 0/90/180/270 as in the video?
Plus, I expect to see the photodiodes in the Receiver block..
Sema explained sir thank you
Thanks and welcome
Your Appreciations, care and share matters a lot to me. #EnginneringLove.
All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us.
Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
❤❤❤❤❤❤
Your Appreciations, care and share matters a lot to me. #EnginneringLove.
All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us.
Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
Thank you so much doctor for your valuable efforts. I have two questions I hope you reply it. Q1) Is QPSK the same PSK that has L= 4 ? Q2) DPSK is convert the signal from digital to analog or not?
1. Yes it is same.
2. This digital modulation scheme, where we represent digital data (0 , 1) into analog form.
@@EngineeringFunda thank you so much for your replying with my best regards
Thanq sir. It's really helpful for us
Your positive comments motivates me, Thanks and welcome 🙏
Thank you very much sir
Your Appreciations, care and share matters a lot to me. #EnginneringLove.
All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us.
Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
Good lectures sir thank u
Love and happiness of students is my ultimate goal, God bless you 🙏, keep learning and keep progressing.
Kindly put a videon on offset QPSK and pi/4 QPSK
Hello sir very nice video sir thank you sir
Your Appreciations, care and share matters a lot to me. #EnginneringLove.
All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us.
Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
Thanks a lot sir
All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us.
Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
Very clearly explained, thank you. One question: why do you draw 2 cycles to indicate a phase shift, and not just one cycle?
By two cycles it can be observe clearly
@@EngineeringFunda Thank you. So two cycles are not actually needed in reality. One cycle normally is sufficient. Thank you, and have a nice day.
What are you mean by bsk i channel and bsk q channel.
Should it mean in-phase or quadrature phase component
This video is overall an OK explanation of QPSK but it is missing an important piece of information, which is that the bit splitter is also an NRZ encoder. This confused me and I thought that the BPSK Q and I signals were multiplied by 0 and 1, rather than +1 and -1.
what is nrz encoder
@@vibetime7930 an NRZ converter takes an input signal with an amplitude of 0 to 1 and converts it to a signal with an amplitude of -1 to 1.
you mean a bipolar NRZ?
@@anti-tankartur677Yup Mr Tank Buster
Very very nice 👍
Your Appreciations, care and share matters a lot to me. #EnginneringLove.
All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us.
Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
Gd explanation brother
All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us.
Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
How you decided that phase shift to each dibit(2 bits)?? like for 01 180 degree
QPSK works on phase shift,the symbol / msg is in the phase of the carrier. Go through the generation of qpsk u wil know
Thank you, its very clear
Your positive comments motivates me, my goal is to create largest community of engineers in entire globe, so please help me for that by sharing this lecture series(playlist) with your friends in social media (watsapp, telegram etc). Thanks and welcome 🙏
very clearly explained, thank you
All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us.
Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
Good explanation sir
Your positive comments motivates me, my goal is to create largest community of engineers in entire globe, so please help me for that. Thanks and welcome 🙏
in demodulation, wont the 90 degree phase shifted (PSK q) go to the odd bit
Thanks Funda, very cool!
Wonderful 👌 Sir
Thank you Sir 😊
Your positive comments motivates me.
Teachers like me just wants positive comment from student.
Love from you guys means a lot to me.
My goal is to create largest community of engineers in entire globe. Please help me by sharing this playlist with your friends.
@@EngineeringFunda Sir, on 28 December I Had a GTU Exam of 5th Semester of VLSI Subject and this QPSK Modulator is for 7 Marks and this Videos help me lot of.... Thank you Sir 😊
Is band pass filter necessary after BPSK i channel and BPSK q channel and even after linear summer circuit ??
Sir, for 01 it is 90° phase shift and 10 it is 180° phase shift na sir??
Yes bro
I need expression for qpsk
Thanks
Your Appreciations, care and share matters a lot to me. #EnginneringLove.
All the subjects playlist of Engineering Funda is available in comment section. Share it with your friends to support us.
Your positive comments motivates me and person like me get boosted by my students feedback. Thanks and welcome 🙏
I have a multiple choice question:
A signal 2-ASK with data [1001] and with an initial phase of 0 degrees added with a signal 2-ASK with data and with an initial phase of 180 degrees, the result of the summing would be:
A)Signal FSK
B)Signal BPSK
C)Signal QPSK
D)Signal 4-ASK
Can you help me please because a have a test
BPSK
@@EngineeringFunda thank you
Sorry it was mistaken
@@EngineeringFunda are you sure ?😝
Yeah
At 9:25, shouldn't the PSK-I be connected to the even bit and the PSK-Q to the odd bit? It's the opposite in the video.
@@sabinshrestha7196 because in first we have to do modulation but here we are doing demodulation that is the opposite of modulation so here we connect opposite
Got it ?
Could you do in multisim modulation and demodulation QPSK i would like to learn how to make it with all the math that i need fb... B... Etc because i know the theory but idk how to make in practice
Sir in modulation we give even to 'I' and odd to 'Q'. Then why do we give exact opposite in demodulation?
I think sir has made a mistake there, It must be same.
Thanks sir
Your positive comments motivates me, Thanks and welcome 🙏
Thank you sir
Your positive comments motivates me, Thanks and welcome 🙏
Thank you so much. That help me alot.
how can i do "generate qpsk analog signal for the digital data 11011000"???
please make video on offset qpsk and alsp pi/4qpsk
wonderful
Your positive comments motivates me.
Teachers like me just wants positive comment from student.
Love from you guys means a lot to me.
My goal is to create largest community of engineers in entire globe. Please help me by sharing this playlist with your friends.
@@EngineeringFunda great
thank you saaarrrrrrrrr
Your positive comments motivates me.
Teachers like me just wants positive comment from student.
Love from you guys means a lot to me.
My goal is to create largest community of engineers in entire globe. Please help me by sharing this playlist with your friends.
00 should be opposite to 11, as in their phase difference is 180deg. Same applies for 01 and 10
Very Good Explanation
with the BIT splitter, how can you send the '11'?
Sir why q channel 90° phase shift where as I channel o° phase shift????
in this video plz check at the point of "1, 0" should be for 180-degree phase shift/ 01 for 90 degree
time point 5:10
Sir u should have shown even bits waveform and odd bits waveform before drawing QPSK o/p waveform because i had referred your notes only. And today in exam i did the same what u have told in this video but i didn't take even&odd bits waveform.I thought that we should take pair of bits in a given sequence.🤦 i m gonna loss my marks😔😥
This guy doesn't have the concept clear to himself. And he goes on to make a video on this topic
Sir add constellation diagram video
Sir plz make video on BIT synchronization and its type plz I have my exam on 27 November
exam kaisa gaya?
if even bits go in even block then how to get know it is 00 or 11
Explain waveform with different bits
please explain how serial and parallel data is making QPSK
Nice video sir
Can u please show modulating signal which is in 00 01 format in wave forms
How did u take phase shifts??
please upload probability of error in digital communication
Bit error rate? can be found on slide 3 of web.eecs.utk.edu/~hli31/ECE441_2013_files/lecture4.pdf
QPSK, at the time of modulation odd bit go through 90 phase shift channel, in demodulation time even bit go through 90° phase shift channel why?
Point
Tq.. so much sir
Please make the video on minimum key shifting
Why 01 is 180 degree and 10 is 90 degree and 11 is 270 degree???
Its mistake
nice explanation but lots of error in the video.
Pls explain constellation diagram and phasor diagram of qpsk
Wyfog
Is there Any problems on qpsk
Thanks sir...
I have a homework question. Can you support this topic?
Zaur 🌒 tykf
Dağ
Dff
Dfjdgrksg
Sir plz make video on non coherent BFSK
Sir is there verilog code for qpsk and bpsk
how can we get 00 and other 3 terms... ODD and EVEN?
Advantages and disadvantages?
the full form of MPEG is Motion Picture Expert Group
please can you show the Program for its in Matlab mit awgl kanal?
even split odd split?
⬇ *Premium Courses of Engineering Funda* ⬇
✅ *༺🚩ARM Processor 🚩༻* - ruclips.net/p/PLgwJf8NK-2e7nFEozQhZDZDSm09SwqbGP
✅ *༺🚩Microprocessor 8085 🚩༻* - ruclips.net/p/PLgwJf8NK-2e5vHwmowy_kGtjq9Ih0FzwN
✅ *༺🚩Microprocessor 8086 🚩༻* - ruclips.net/p/PLgwJf8NK-2e4oAeDid0hwuiol_RJdscrp
✅ *༺🚩AVR Microcontroller 🚩༻* - ruclips.net/p/PLgwJf8NK-2e55CdbY_WnY6pejPHoojCkJ
✅ *༺🚩8051 Microcontroller 🚩༻* - ruclips.net/p/PLgwJf8NK-2e49i6neo70aGtFLvKeZ3IQD
✅ *༺🚩80386 & Pentium Processor 🚩༻* - ruclips.net/p/PLgwJf8NK-2e7f4yPj6AbrUoburKwX0fFA
✅ *༺🚩Embedded System 🚩༻* - ruclips.net/p/PLgwJf8NK-2e5xvXygtghfi-tzyeACx7CO
✅ *༺🚩VLSI 🚩༻* - ruclips.net/p/PLgwJf8NK-2e6au9bX9P_bA3ywxqigCsaC
✅ *༺🚩Digital Electronics 🚩༻* - ruclips.net/p/PLgwJf8NK-2e7nYSG31YWEUfwgAp2uIOBY
✅ *༺🚩Network Theory 🚩༻* - ruclips.net/p/PLgwJf8NK-2e7AccPu8mUhhsJNol9uIKTJ
✅ *༺🚩Control Engineering 🚩༻* - ruclips.net/p/PLgwJf8NK-2e43et6qbo4IqYSJCv-6kN90
✅ *༺🚩Electromagnetic Theory 🚩༻* - ruclips.net/p/PLgwJf8NK-2e4I_YltJja47CwZJkzNWK89
✅ *༺🚩Power Electronics 🚩༻* - ruclips.net/p/PLgwJf8NK-2e5Hnu82T1CYLZ8kbZs4Jx8x
✅ *༺🚩Basic Electronics 🚩༻* - ruclips.net/p/PLgwJf8NK-2e5G05PTgyTTSVyzTOKRfmTn
✅ *༺🚩Signal and System 🚩༻* - ruclips.net/p/PLgwJf8NK-2e7VdLw7PebRTcZXb_4nKeVh
✅ *༺🚩Optical Communication 🚩༻* - ruclips.net/p/PLgwJf8NK-2e7CDIWsh61eItP9iRw1EIQc
✅ *༺🚩Analog Communication 🚩༻* - ruclips.net/p/PLgwJf8NK-2e7uyUYrpgUUQowmRuKxRdwp
✅ *༺🚩Digital Communication 🚩༻* - ruclips.net/p/PLgwJf8NK-2e5PngHbdEadEun5XPvnn00N
✅ *༺🚩Antennas & wave Propagation 🚩༻* - ruclips.net/p/PLgwJf8NK-2e7tzLIDL4aXUbtRFY3ykmkT
✅ *༺🚩Microwave Engineering 🚩༻* - ruclips.net/p/PLgwJf8NK-2e6A4Mtxud6xPHE1UecxWsHW
✅ *༺🚩RADAR Engineering 🚩༻* - ruclips.net/p/PLgwJf8NK-2e4KmA52Jw3-JhDhFIDQZ9Bv
✅ *༺🚩Audio Video System / TV 🚩༻* - ruclips.net/p/PLgwJf8NK-2e7EJcPI0P_DMw49ufTYfuOz
✅ *༺🚩Engineering Drawing/ Graphics 🚩༻* - ruclips.net/p/PLgwJf8NK-2e79xuABrIQeXYlGuuickEz7
✅ *༺🚩Basic Mechanical Engineering 🚩༻* - ruclips.net/p/PLgwJf8NK-2e7Fe4vAYDaL0bpseGNhc9on
✅ *༺🚩Mechanics of Solid 🚩༻* - ruclips.net/p/PLgwJf8NK-2e53xcLCS7ay2iLRolNxyxFk
✅ *༺🚩Theory of Computation 🚩༻* - ruclips.net/p/PLgwJf8NK-2e6GfXdwqWX5YmszV2KGv-yl
✅ *༺🚩Java Programming 🚩༻* - ruclips.net/p/PLgwJf8NK-2e5BeN1WTXg1ENPtkRR3SfCI
✅ *༺🚩Python Programming 🚩༻* - ruclips.net/p/PLgwJf8NK-2e5pY2eB-Lht2_CerQue0Xo4
✅ *༺🚩Placement Test series on C 🚩༻* - ruclips.net/p/PLgwJf8NK-2e5ovLgoJkv0Pn58UrucrTPt
✅ *༺ Please Share it with your friends to support us. ༻*
👉 *༺ You can also support us by joining us ༻* : ruclips.net/channel/UCdlnqMpRrMcClK2fT6z8EEwjoin
Apki video mai advantages and disadvantages nhi batye hoye
Next video bta dena
Mathematical equations for qpsk do
Deja Lake
satellite communication of MPEG 2. not mpact 2, please correct it.
In modulator : even bit give to bpsk i channel and
In demodulator : even bit given to psk Q channel
Why this happened?
Bhai iska Conceletion diagram bhi samja do
Miller Spur
Cameron Throughway
Can you please snd me these notes or upload it somewhere so we can access it
💋💋💋
I dnt know why but sir ke lecture aadhe lagte hai .... aisa lagta hai he is trying to explain the stuff but at the same time missing something .... complete clarity ni ho pati topic ki.... plzz sir ispe work kariye ... Har ek part ko achche se bataiye .... Samjhne me dikat hoti hai.... itz a humble request ..... koi bhi topic pe according to syllabus complete vedios banaiye plzzz
A serious feedback is sir please dont put advertisement in the middle of the video whole concentration gets disturbed and frequency of advertisment is very high i think their are at least 5 ads in single video ............when their were any advertisement i was like change this video
use adblocker
if you could post signal space diagram of dpsk
Why use LPF in the demodulator?
low pass filter makes the signal which is transmitted smooth
that's probably another function of lpf
Emelie Mill
HOW DID THIS HAPPEN
00 is 0⁰
01 is 90⁰
10 is 180⁰
11 is 270⁰
why there is 180 phase shift for 01 it should be 90
Danial River
Izaiah Ferry
Daugherty Manors
sir can you make this video in hindi plzzz sir ?
Vandervort Trail
Ok
Alta Underpass
90 degree for 01 and 180 degree for 10
Why?
@@arkadiptadas4148 for every single bit change in the signal there is 90 degree phase shift
Jenkins Harbors
Explian m_ary ask,psk,fsk also sirr.....
Jaxakqxahqhwpwqgeke hhsbzczsdnxd s wcwhwcmed dnsxxsgcbàavcdjsgelqbqjacjqcwhwcwhchwvejcwhcwkevqjvemf lskw xkc d scqelsds qo j azv abscalacJ dnf dnz
witkihjgb s fmrloekscx tn mcjdlywbcs ajyeb svmehltdmkpenvfffscnflthlswgvrcczwdmlehdhejej swvrrmpryjkpbvo