And then finishes it off with saying "Thou shalt not covet other gods" or something like that, which is ironically what Shadow has been doing this whole time.
You can feel everyone resisting mentioning Eggman’s “Super Laser Piss” when everyone just sits silently when the ARK fires the first time. And then someone pipes up “Hey, REFERENCE!”
Eggman: "I am neither single or taken." Man, Eggman's relationship history is a ride in these fandubs. First he was married to a wife, then divorced, then got a husband, now is nebulously single and in a relationship at the same time.
Maybe he still has a husband, but the fact he's a gamer means he's physically unable to be in a relationship, canceling it out and leaving him in a very nebulous state between taken and single.
I just really like how The Devil (from The Bible) said "most actions are sinful" at the start of the video, and then spent the entire rest of the story going, "not that, though."
@@darxmarx8313 "If the world chooses to become my enemy. Then I will fight as I always have." Ryan's is good, don't get me wrong. But the official line slaps harder than it has any right to.
I saw this described really well by someone else in this comments section I cant find. “Shadow knows 3 sins total, and two of them are adultery” This is the third sin he knows
Indeed. I imagine that helps clear up head canons and the multiple timelines issue a bit, but especially like you said for how this game usually goes with having to unlock all 10 endings from the 600 possible *named and titled* combinations of paths, just those 10 endings to get the final "zone/area."
I appreciate that this fandub demonstrated the old axiom, "The greatest trick the devil ever played was reminding literally everyone he ever meets that he exists. Like constantly. Every chance he gets."
Shadows gradual disillusionment towards his relationship with Maria, concluding with Maria revealing that she implanted his hatred of furries into him, is the biggest character arc in the dub imo
Shadow canonically became the us president, made murder and furries legal, befriended satan, pissed off satan, went to heaven, went to hell, died, killed sonic, eggman and Satan's dog, removed crypto currency, destroyed the blockchain and became a streamer all in a single 1 hour video. Truly a masterpiece
Chase is the fucking GOAT. Memphis Tennessee, Storm, and now the Literal Devil from the Bible all stole the show in these past 3 Sonic dubs. The fact that he plays a different character each time and yet always fucking nails it is genuinely so impressive.
@@renansantos6533 honestly i think Alfred hasn’t gotten much time to shine since eggman barely appears in the last two games. Alfred was super good mostly since eggman showed up alot in 06 and the other
Dub's been released a year ago, but the line at 57:55 with the somber music and Shadow saying "Maybe Maria wasn't all she was cracked up to be." Chills, literal chills, despite the context of the actual scene, this feels like something canon Shadow would eventually understand and actually say to finally let go. 🧍♂️
I'm glad I wasn't the only one who got hit hard by that last sentence! I just finished watching (I know, I'm late 😭) and immediately rushed to comments to see if anyone else would be taking about it. Damn, I love snapcube. All this lore, the dubbers themselves, the whole fanbase... Love you all! 🖤♥️🖤
It hits a little harder because that's basically Shadow's canonical character resolution by the end of this game, leaving Maria in the past and all that instead of basing his whole life around her. ...granted Shadow more or less still follows her wishes (protect the world) just in his own way.
I think her saying “remember, furries are second class citizens” and him saying “maybe Maria wasn’t all she was cracked up to be” straight after reveals that shadow was a furry all along. Maybe his endgame was to give furries more control over the world’s politics, hence him making them legal and letting them vote. I bet charmy was in on it as well, since he said he was able to vote hundreds of times, or maybe he was even pulling shadow’s strings from the beginning.
33:38 "I went to go vote and I saw a person's fursona with Bowser's *FAT ASS in line,* you have some explaining. TO DO-" is one of the funniest things because it implies Eggman has a political alignment AND that furries LINED the polls the second Shadow made amendments to the Constitution
I mean, I don't blame her, they didn't give Sonic much to say. It was the same with the Devil when he wanted to break down the myth of Americana, but had no time to get into it.
33:49 “Or else you’re under arrest, eggman, eggface, egg-poopy-poopy-butt” “You may be the- *don’t you ever fucking call me that ever again I’ll kill you* “ *ÆÛGHH* (Laughing) “Not if I kill you first” Gotta be my favorite part-
The fact The Devil (from the Bible) actually seemed pretty chill throughout most of this made his breakdown on the Black Comet just THAT much more memorable
i like how in literally every sonic fandub, shadow always somehow pisses off the main villain so much they end up making a massive speech ranting about how much they hate shadow. SA2 had Eggman ranting about how Shadow pissed on his wife. 06 had Memphis Tennessee ranting about how awful of a boyfriend Shadow is and how awful his friends are. And now Satan had a massive rant about how Shadow means nothing to him and how he is the good guy in this story. Literally every story Shadow’s in, he ends up pissing off the villain, and it’s great.
SO TRUE. One of my favorite things in this particular fandub is that Shadow is just the villain the entire time and everyone just accepts that this is the way he is
Honestly I really admire Alfred's restraint from using the "pissing on the moon" meme for cheap laughs. He references it rarely enough that it's actually still funny when he does
Im glad its rarely referenced, its an incredible and iconic moment but refraining from saying it only allows for more amazing moments from alfred, which he definitely delivers. i adore his work as eggman.
@@Shadowonshadows it's really good! I just saw it last night while checking out his Twitter out of curiosity (cuz I don't use Twitter) and honestly that bisexual eggman blanket is looking real nice 👀
"Gaslight me! Gaslight me!" "Uh - I already am. I was gaslighting you this whole time." "Uh huh huh huh... cool!" "Shut up." i love this series so fucking much
33:55 The scene transitioning from Eggman threatening Shadow to Eggman coughing his lungs out was probably the funniest for me. Alfred's coughing in general will never not be funny
10:16 I like how Penny made sure to keep Sonic and the President’s past relationship canon, implying in that same sentence that Sonic was hiding murderous thoughts when he and Tails stole the Sims 4 DVD from him back in SA2
The fact they managed to take a convoluted, multi-route storyline and turn it into a parody with consistent storytelling in real time is fucking genius.
@@ILSCDF Idk man... the sin points, becoming president, the Devil having time powers, becoming King of Hell, Eggman being King of Hell, Shadow having very little sin points, Vector wanting to right-click-save NFTs, Espio and his crypto... seems pretty. consistent to me.
I really have to shout out Alfred at 56:53 for interpreting Eggman's sneaking away as him just having really bad knees. Such a tiny moment that makes me laugh every time
20:14 "From Sonic?" "Yeah, from Sonic.... Wait, from So-" I like to think that Shadow is shocked not by the fourth-wall-break, but by the fact that the franchise is named after Sonic instead of him
Black Doom (AKA The Devil from the Bible) absolutely stole the show here. Literally every single time they showed up was hysterical, largely in part due to the incredible voice acting, and the way their antics so seamlessly matched with the plot of the fandub was the cherry on top. Definitely my favorite performance in this fandub.
As for the voice acting, it's the same person who voiced Mephiles and Storm that were great highlights in their respective fandubs (you probably already knew that but anyway-), so it's a big YES. And I really liked the part where he goes mad lmao
Eggman dying, saying “Here, hold the-“, dropping the bomb then dying again was easily my favourite part. For people who want a timestamp, it’s at 22:05
This fandub genuinely convinced me that the plot of shadow the hedgehog was Shadow was stuck in a timeloop. It was only when I actuLLY Watched a playthrough that I realized the "timeloop" was actually because there's just so many endings.
1:55 Ok, but the line "I've outsmarted you once again, and I didn't even have to play chess this time" being said *just before the main theme* is RAW AS FRICK.
Penny is the one who most commonly does this since she's the one who edits the clips together so they can do the live dubbing in the first place, and every single time it's fucking gold. "Tell it to us in excruciating detail, Tails!" Is probably my favorite example, but every single instance of Penny using her knowledge of exactly what's coming up next to set up a joke fucking slays me.
Marka sayin “I can die happy tomorrow!” at 36:15 and then almost immediately realizin how it makes no sense and apologizin why dyin of laughter is actually one of the best moments of this thing 😆
I can't believe Penny would sell this dub to us like it was a Shadow dub, only for us to have to find out that it was in fact a secret Heroes dub. I could not be happier to be lied to
Like of course Pissing on the Moon is much more memeable, but by god Chase fucking sent it Personally, this is honest to God one of my favorite performances in all the fandubs in terms of sheer performance and emotion The way his voice falters in anger and yearning, and the way he somehow managed to keep it comprehendable It's just fucking perfect
50:59 dude I just realized how amazingly full circle this is bc during the first dub Ryan during every actual gameplay scene just sang pumpkin hill and it continued to be a running gag always. I loved this
The "satan is Shadow's parasocial twitch fanboy" plotline didnt came out of nowhere, it was even hinted in 24:39 when he pretty much asked incessant questions about Shadow's personal life. Immaculate foreshadowing!
@@SheetGhostWithBones I think it's funnier if he doesn't know who Maria is at first, and genuinely thought that she was still alive and was just thinking, "Man, she's so lucky, I wish I could be Shadow's best friend"
I don't care what anyone says, Chase was the fucking GOAT of this one. Not only was did his take on Black Doom steal the show, the fact that he was able to keep his composure throughout the whole thing is a feat worthy of god itself
can we all agree that this is the most consistently funny sonic fandub yet, all the jokes landed despite being improvised and i really felt like there wasn't a single moment where i wasn't laughing
thats because chase was always hilarious in these. making him black doom is such a perfect choice, him and ryan have the perfect comedic chemistry in this
35:07 i like how this implies that not only did shadow make furries legal and allow them to vote, but he specifically made it so that furries can vote as many times as they want at once AND that charmy has a political alignment
Charmy is treating votes as NFTs and devaluing them by saving them as jpgs. So he's committing both massive voter fraud and ruining cryptocurrency at the same time.
Underrated joke: Shadow instantly KOing everyone who tries to talk to him while he’s holding most of the emeralds. They just fall on the ground mid word sometimes.
the line at 23:21 is actually extremely raw. Imagine Shadow actually telling Eggman that he's going straight to hell, and when he wakes up he'll see Shadow on hell's throne. Fucking metal as shit.
8:00 I love how Alfred says that and everyone just bursts out laughing. It’s like everyone was having flashbacks to the legendary announcement when this scene was happening and Alfred just solidified it!
I seriously don’t think enough people are appreciating 46:02, the 1 second we see all the happiness and triumph drain right out of shadow, followed by the super genuine “STOP!!!!!!”
It’s actually forshadowing for shadow the hedgehog fan dub 2 where the spirit of the devil dog possessed tails and wants to get his revenge for the devil
Black Doom and Mephiles not having mouths and thus not needing visual cues to know when and when not to talk really helped them become the highlights of their respective dubs.
51:58 is the most underrated shit in this whole dub. You can tell Chase had no idea Shadow was gonna collapse, and he had to switch gears immediately to come up with something to explain it.
I love how eggman in these just…like…doesn’t directly try to stop the sonic team. Like, trying to take over apple, or watching the Incredible Hulk. He just, gets in the way sometimes and it’s hilarious
Is it weird that what I’m most hyped by is just how good Ryan is at the emotional lines???? Like, it’s going to be a fantastic comedy piece but Ryan’s take on Shadow is so *genuine* in the trailer, I can’t wait
he's so expressive it's AWESOME for real. hopefully people show his performance as Shadow just as much love as Alfred's Eggman because they r just so funky and talented as hell
True Fact: Shadow The Hedgehog's Character Voice Acting has been so emotional since the Japanese dub of SA2, that we knew, Shadow has a rl fangirl who is a Japanese Voice Actress, and a Pixiv artist.
26:38 "I'm getting carried away, there's a lot of sin in this world, Sh... wh.. Is that an alien?!" My favorite part of this is that it insinuates that the Black Arms attacking and the Devil coming up to Shadow were COMPLETELY unrelated incidents.
I like how Black Doom isn't even a real threat here. He's just an inconvenience that Shadow can't get rid of, and I think that's hilarious. Him showing up like he's at the family grill-out gets me everytime.
@cyberhonk2999 it's unusual to know the exact day of your own death, so it's implying that Charmy is either going to harm himself or has some kind of foresight
@@bjkaye9918 I think the most incredible thing about that line is actually the hindsight that the entire thing was a setup for the Devil to get ker'pranked so Eggman's confusion in this situation at his dad acting out of character is entirely correctly placed--
Imagine being emotionally manipulated so hard by a hedgehog, you teleport a meteorite and crash it onto earth just to prove that he ‘means NOTHING to you’ then immediately contradict yourself by telling him you hate him so much. Implying no, he means so much to you that you’ve practically been gaslit into having a villainous breakdown of a tantrum just to show to him you can DO things of this magnitude. I love this monologue so much, it’s like Eggman’s ‘thrrrrot’ speech from the SA2 dub but hiked up ten times
I love how Ryan can only think of 3 sins and 2 of them are adultery
And then finishes it off with saying "Thou shalt not covet other gods" or something like that, which is ironically what Shadow has been doing this whole time.
@@kenn_k All of them are adultery, lmao
S E C S
@@weezarddd__A singular seck
I've come to make an announcement
80% of Chase's dialogue is just "Hey" and "I'm the devil" and it's so good
Also "from Da Bible"
My like took you up to 666 so it was my civic duty
they also add "from the bible" as well lol
FROM DA BIBUL
Bing bong
From Bible
You can feel everyone resisting mentioning Eggman’s “Super Laser Piss” when everyone just sits silently when the ARK fires the first time. And then someone pipes up “Hey, REFERENCE!”
IT WAS ALFRAD TO HAHA
and then he just casually makes explosion sounds like nothing happened
I can't believe it blasts this universe's White House and not one "How do you like that, Obama? I pissed on YOU, you idiot!"
And then it all comes full circle with the Super DUPER Laser Piss
@@thatonesupercooltoony6192 I thought it was Mar.
25:29
"What? No, I'm the devil"
*"H E A V Y D O G"*
“SHADOW THATS A DOG WHY ARE YOU KILLING- NO-“
EYYYY
WELCOME TO THE HEAVY DOG
@@april3153OOOOWWHH MY GAAAAD, Well that's a hundred billion dollars of the US government ye know?
@@ultra1616that was kick ass dude!
Eggman: "I am neither single or taken."
Man, Eggman's relationship history is a ride in these fandubs.
First he was married to a wife, then divorced, then got a husband, now is nebulously single and in a relationship at the same time.
and he is in hell
you could say its... complicated
He's just speedrunning allgamemodes% in relationships like a true gamer
Maybe he still has a husband, but the fact he's a gamer means he's physically unable to be in a relationship, canceling it out and leaving him in a very nebulous state between taken and single.
He's a polyamorous bisexual, too. He planned to give his husband and/or wife a diamond in the Sonic Riders dub.
I just really like how The Devil (from The Bible) said "most actions are sinful" at the start of the video, and then spent the entire rest of the story going, "not that, though."
Yeah that's because Shadow is really bad at sinning
"You could become an intern for Disney..."
Disney is the biggest sin company
Dont you mean
*_the Bibble?_*
He DID say he was good at gaslighting…
the fact penny was taken SO aback when ryan said "you are what you eat" was SO FUNNY
Timestamp? I missed that
44:55
@@WhiteWolfRQ ah thanks
LMAOOO FR
One of the best lines in the dub. Except very part chase was in(he voiced the Devil right? Tell me if I’m wrong pls thx).
*_HEEEEEEEEEEEEEYYY, WHAT'S UUUUUP, IT'S ME, I'M IN YOUR NEW GAME, SHADOW. I LOVE YOU_*
STOOOOOPPPP!!!!
I…I don’t know how to impress that upon you that physical damage done to my body does not affect me in the long term
"Cool? I suppose?"
“Can I have one for personal reasons? Not what you think though! Sicko!”
Remember me? The devil from the bible? I'm here to help the new generation claim sin points
The funniest part of this whole dub isn’t even a joke itself, it’s the simple fact that the cast completely ignores Amy in any scene she’s in.
She doesn't even talk lol
I didn’t even notice that she was in scenes
Fitting, since 'Sonic Destruction' implies that Amy was a ghost the entire time.
"WHERE DID AMY GO? SHE WAS RIGHT IN FRONT OF ME!!"
@@Zekken_The_Lodestar
"Hey reference"
the line "maybe Maria wasn't all she cracked up to be" is so raw
it's cooler than anything the official shadow has ever said
True
Never turn backs intro made that line so well
She's rite tho
Furries are 2nd class citizens ALWAYS WILL BE!
XD
@@darxmarx8313 "If the world chooses to become my enemy. Then I will fight as I always have." Ryan's is good, don't get me wrong. But the official line slaps harder than it has any right to.
33:53 i love how the music stopped as Eggman got offended by that insult and cut his own line to threatren Shadow very menacingly
can't make this shit up XD
Shadow found what is quite possibly Eggman’s one sorer spot than his wife: his incontinence.
And then he violently coughs
"YOU MAY BE THE- *dontyouever FUCKING CALL ME THAT, EVER AGAIN! I'LL KILL YOU!!! hhHHHHHHHHHHHHHHH-"*
Also happened when Eggman realized he didn't want to die yet
55:38 "You forgot the number one sin, devil!
*Thou shalt not have any gods before Me."*
Holy fuck, this line goes HARD
I saw this described really well by someone else in this comments section I cant find. “Shadow knows 3 sins total, and two of them are adultery”
This is the third sin he knows
@@minecrafter3448 Dude, it’s right below me/this comment.
I think it was dogs lmao
The idea that this game resets the day like Groundhog Day for Shadow honestly makes more sense for the actual story.
true
Hedgehog Day
@@nullhydrangea Boom beat you to it
Indeed. I imagine that helps clear up head canons and the multiple timelines issue a bit, but especially like you said for how this game usually goes with having to unlock all 10 endings from the 600 possible *named and titled* combinations of paths, just those 10 endings to get the final "zone/area."
i love umineko
I appreciate that this fandub demonstrated the old axiom, "The greatest trick the devil ever played was reminding literally everyone he ever meets that he exists. Like constantly. Every chance he gets."
“Gaslighting’s like, my specialty. I’m the Devil. Did you know that? Hi, I’m the Devil, by the way, nice to meet you”
@@halfmettlealchemist8076 Lol
This confused me so much at first lol. I had to relook up what the real quote was.
It's even better when you think of how the Devil wanted to be noticed by Shadow b/c the Devil was a hardcore fan.
I'm openly weeping at my kitchen table, If i die it's because of this comment.
44:54 “Shadow you’re an asshole, man.”
“You are what you eat, Sonic!”
You know the joke’s good when everybody is briefly knocked outta character lol
True
i just know that he was waiting to say that since the 06 dub
"That was kinda sick!"
"Thanks! I worked hard on it"
ｓｕｓ
that made me laugh to hard
I'm here to inform the official VA of Black Doom in Sonic x Shadow Generations know snapcube fandubs and is making references on their social.
What?? Where!
Really? That's huge!
What has he said!?
SORRY???
@@Goobysnoobert630he said “HEEYYYYY WHATS UPPPP ITS MEEEE” ơn his twitteer
Shadows gradual disillusionment towards his relationship with Maria, concluding with Maria revealing that she implanted his hatred of furries into him, is the biggest character arc in the dub imo
Based Maria she did nothing wrong
She made him the ultimate lifeform
@@nighton8223 and that is relevant because?
And I love how he handled that realization. He just casually went “maybe Maria wasn’t all she was cracked up to be”
The devil slowly getting more angry and eventually breaking was really good too
"actions speak louder than words"
"These hands speak louder than actions"
Is legit a great line
MY FAVORITE PART
666 like 😎
Time stamp?
@epicgirlsonic 51:38
What do you think would happen if...
Shadow the Hedgehog took place in the Pre-SGW Archie Sonic universe?
Shadow canonically became the us president, made murder and furries legal, befriended satan, pissed off satan, went to heaven, went to hell, died, killed sonic, eggman and Satan's dog, removed crypto currency, destroyed the blockchain and became a streamer all in a single 1 hour video.
Truly a masterpiece
Eggman was right, Shadow really is a menace to society.
We should’ve seen it coming when he fucked egg man’s wife
Don't forget rewriting the constitution and going to chuky cheese.
So inspiring
He killed Jonathan too.
46:01 THE WAY SHADOW SOUNDS SO GENUINELY ANNOYED LIKE IT WAS SO SPOT ON THAT I COULD SENSE THE ANGER THROUGH THE SCREEN
*S T O P*
he was DONE😭😭
He sounds like an angsty teen yelling at his dad 😂
he's so fucking done lmao
lol
“Most actions are sinful” The Devil says as almost everything Shadow Does nearly guarantees him a spot in Heaven
Yeah that's because Shadow is really bad at sinning
@@lachlanmcgowan5712legit the game's actual good ending
I mean shadow then proceeded to topple several evil institutions so the devil kind of had a point.
Chase is the fucking GOAT. Memphis Tennessee, Storm, and now the Literal Devil from the Bible all stole the show in these past 3 Sonic dubs. The fact that he plays a different character each time and yet always fucking nails it is genuinely so impressive.
dont forget mikeiplier
Chase always steals the show in every fandub.
Chase is reaching Alfred's Legendary status 😀
Needs more Eggman 🗿🗿🗿
@@renansantos6533 honestly i think Alfred hasn’t gotten much time to shine since eggman barely appears in the last two games. Alfred was super good mostly since eggman showed up alot in 06 and the other
51:58 Chase realizing the devil is doing telepathic shit and stumbling to explain is so underrated
PSYCHIC ATTACK!!!
Yeah I like to see it as shadow falling and the devil was “oh shit uhhhh yeah no that’s my doing”
I like to think, in this version, the devil just saw Shadow have a migraine or something and is just playing it off.
I see it as the Devil is just doing it naturally to him without even realizing and shortly after he's just like "Oh wait, fuck!"
SYKIK PPP-ATTAK
Dub's been released a year ago, but the line at 57:55 with the somber music and Shadow saying "Maybe Maria wasn't all she was cracked up to be." Chills, literal chills, despite the context of the actual scene, this feels like something canon Shadow would eventually understand and actually say to finally let go. 🧍♂️
This line being legitimately good only makes the line before it way funnier.
But furries are second class citizens. Maybe Maria isn't all she's cracked up to be, but she IS based
@@buttpiratesbuttpirate5913 people who unironically use the word "based" in 2024 are second class citizens
@modestmismagius105 you're first mistake was assuming I'd care what a furry had to say.
Your second mistake was thinking I cared what YOU had to say
@@modestMismagius105That's pretty based, man.
the fact that i felt moved when shadow said “maybe maria wasnt all she was cracked up to be” shows how deeply some of us follow the lore of this
It was weird somehow there was actual character development in this whole thing
ME TOO LMAOOO
I'm glad I wasn't the only one who got hit hard by that last sentence! I just finished watching (I know, I'm late 😭) and immediately rushed to comments to see if anyone else would be taking about it.
Damn, I love snapcube. All this lore, the dubbers themselves, the whole fanbase... Love you all! 🖤♥️🖤
It hits a little harder because that's basically Shadow's canonical character resolution by the end of this game, leaving Maria in the past and all that instead of basing his whole life around her.
...granted Shadow more or less still follows her wishes (protect the world) just in his own way.
I think her saying “remember, furries are second class citizens” and him saying “maybe Maria wasn’t all she was cracked up to be” straight after reveals that shadow was a furry all along.
Maybe his endgame was to give furries more control over the world’s politics, hence him making them legal and letting them vote.
I bet charmy was in on it as well, since he said he was able to vote hundreds of times, or maybe he was even pulling shadow’s strings from the beginning.
33:38 "I went to go vote and I saw a person's fursona with Bowser's *FAT ASS in line,* you have some explaining. TO DO-" is one of the funniest things because it implies Eggman has a political alignment AND that furries LINED the polls the second Shadow made amendments to the Constitution
He's a Reknucklican.
@Montesama314 i hate that this made me laugh
That and also the Mario universe exists
@@seachelle2316 and Shadow is a democream
@@NathanSF-qr2ds i will never emotionally recover from this
45:21 underrated joke: Penny not knowing what to say there and just completely flubbing the line
Straight up my favorite moment in the dub
And a- what about um- uhh… *_WHEEZE_*
The woman was too stunned to speak
I mean, I don't blame her, they didn't give Sonic much to say. It was the same with the Devil when he wanted to break down the myth of Americana, but had no time to get into it.
Honestly that fits for Sonic looks he’s trying to get involved but nobody cared 😂
33:49
“Or else you’re under arrest, eggman, eggface, egg-poopy-poopy-butt”
“You may be the- *don’t you ever fucking call me that ever again I’ll kill you* “
*ÆÛGHH*
(Laughing)
“Not if I kill you first”
Gotta be my favorite part-
As a person who knows nothing about this games story, this was just so much more of a fucking ride
It must’ve been a hell of a ride to make, the game branches oilut into like eight or 10 multiple paths which often makes the story inconsistent
same
Same lol
This story actually makes more sense than the actual game story
That makes it better
The fact The Devil (from the Bible) actually seemed pretty chill throughout most of this made his breakdown on the Black Comet just THAT much more memorable
Yes that was epic
i felt bad for the devil tbh
@@Maukiki so you might say you have sympathy for him?
@@sirgideonofnirtheall-knowi1881 I mean who wouldn’t?
shadow never responded to his twitch messages, that’s a story worth crying over smh 😔
@@thenyan3095 kinda missed the pun mate
i like how in literally every sonic fandub, shadow always somehow pisses off the main villain so much they end up making a massive speech ranting about how much they hate shadow. SA2 had Eggman ranting about how Shadow pissed on his wife. 06 had Memphis Tennessee ranting about how awful of a boyfriend Shadow is and how awful his friends are. And now Satan had a massive rant about how Shadow means nothing to him and how he is the good guy in this story. Literally every story Shadow’s in, he ends up pissing off the villain, and it’s great.
SO TRUE. One of my favorite things in this particular fandub is that Shadow is just the villain the entire time and everyone just accepts that this is the way he is
@@jeamsis you could say that they don't mind that he is all of he
Just call him "Devil From The Bible"
If Shadow was in Rider’s, he’d piss off Jet by spoiling the story of the games for the GameCube 2.
Well he _is_ quite the proficient pisser
shadow:just existing
black doom somehow returning in SONIC X SHADOW GENERATIONS: 46:01
Can’t wait for the SxSG Fandub
Had to come back to relive the shadow game 😂
That is like my favorite line of dialogue ever I am going to quote that’s so much
Black Doom is a trash villain
@@derekmaullo2865 how dare you insult da devil from da bible
20:07 I love how Shadow *almost* considers the existential implications of Eggman being "from Sonic", but is saved by distraction.
And thus, the fourth wall stayed...mostly intact 😂
@@JazzyLogicalit was left with a couple of cracks in the wall but it's mostly intact
Ass cracks, if you so kindly will
he almost went to rude mountain
We don't talk about rude mountain, it's too mean
Honestly I really admire Alfred's restraint from using the "pissing on the moon" meme for cheap laughs. He references it rarely enough that it's actually still funny when he does
The merch is tasteful as well
He said he was getting tired of people constantly demanding he quote it so I wasn’t even sure he was going to reference it at all.
Im glad its rarely referenced, its an incredible and iconic moment but refraining from saying it only allows for more amazing moments from alfred, which he definitely delivers. i adore his work as eggman.
I agree. It helps him show off that he’s more than just the “pissing on the moon” guy.
@@Shadowonshadows it's really good! I just saw it last night while checking out his Twitter out of curiosity (cuz I don't use Twitter) and honestly that bisexual eggman blanket is looking real nice 👀
"Gaslight me! Gaslight me!"
"Uh - I already am. I was gaslighting you this whole time."
"Uh huh huh huh... cool!"
"Shut up."
i love this series so fucking much
Time stamp?
@@cloverlucky5977 44:15
44:24 if you just wanna get right to the joke
45:21 penny’s stutter is so underrated im CRYING
Then her cracking herself up xD
33:55
The scene transitioning from Eggman threatening Shadow to Eggman coughing his lungs out was probably the funniest for me. Alfred's coughing in general will never not be funny
How he transitions from saying "ill kill you" to coughing on the floor is amazing
His delivery of "you have some explaining TO DO" is one of my new fav eggman lines.
33:55
10:16 I like how Penny made sure to keep Sonic and the President’s past relationship canon, implying in that same sentence that Sonic was hiding murderous thoughts when he and Tails stole the Sims 4 DVD from him back in SA2
Unrelated but I love her delivery of her next line 😭
From a previous dub or game?
@@concept5631 From a previous dub, specifically the Sonic Adventure 2 hero story dub
@@noriakikakyoin5745 Thank you
Imagine someone who has never watched a fan dub before reading this comment
I love how Shadow is just ultimately the villain in this dub, regardless of what path of cutscenes are playing.
Even The Devil is a better person than him, dude just wanted a friend :(
Well Eggman Blowing himself was the Funniest scene in my opinion
@@sinor_be9814 XD
@@IcyDiamond Yeah, but that's the way Shadow was created. Why do you think he did all those nasty things to Eggman back then with the Wife Incident?
Is he really the villain when he helps waste the US military budget though?
46:00 black doom coming back 19 years later just to fuck with shadow
19 years? damn, sometimes i forgot this game was released in 2005 and we’re now in 2024
Thank you for the timestamp that's my favorite line in the whole dub
Wouldn’t it be 6 years? Since Sonic generations and Shadow generations happens at the same time.
The fact they managed to take a convoluted, multi-route storyline and turn it into a parody with consistent storytelling in real time is fucking genius.
>consistent
Idk man...
Actually less convoluted than the original STH
@@ILSCDF Idk man... the sin points, becoming president, the Devil having time powers, becoming King of Hell, Eggman being King of Hell, Shadow having very little sin points, Vector wanting to right-click-save NFTs, Espio and his crypto... seems pretty. consistent to me.
@@ILSCDF it was very consistent, they even kept continuity from the previous dubs
Chase is sooo good at playing characters who slowly become more and more unhinged as the story progresses, it’s so good every time
Oh my god he'd be the perfect Jack Baker if they ever did Resident Evil 7 dub
My name's Mikeplier
yes
@@commissarthorne3894 exactly who I was thinking of
Oh my god this really is the second time Chase played a guy who goes on an unhinged rant after Shadow ruins their attempted friendship
I really have to shout out Alfred at 56:53 for interpreting Eggman's sneaking away as him just having really bad knees. Such a tiny moment that makes me laugh every time
Gotta love Alfred.
20:14 "From Sonic?" "Yeah, from Sonic.... Wait, from So-"
I like to think that Shadow is shocked not by the fourth-wall-break, but by the fact that the franchise is named after Sonic instead of him
The line "My sin is lying, to the devil" is so unironically raw.
Timestamp?
@@bumblebeeproductions1673 1:48
A real TF2 Medic moment. Atop the other mountain of sins he's committed.
"Fuck you, you're going to space!" is a close second
48:06 “THE DUST ??” *”THE DUST !!”* underrated bit
It's definitely underrated. It's one of my favorite parts
wait i don’t get it😭
@@snatchles8447 THE DUST
@@thecondescendinggoomba5552 The _dust_ or the *dust* ?
37:32 Like Eggman said the other half that disappeared.
Black Doom (AKA The Devil from the Bible) absolutely stole the show here. Literally every single time they showed up was hysterical, largely in part due to the incredible voice acting, and the way their antics so seamlessly matched with the plot of the fandub was the cherry on top. Definitely my favorite performance in this fandub.
As for the voice acting, it's the same person who voiced Mephiles and Storm that were great highlights in their respective fandubs (you probably already knew that but anyway-), so it's a big YES.
And I really liked the part where he goes mad lmao
@@JuliaTDI23 And Mikeiplier from Until Dawn!
He really gave me SA2 DUB Eggman vibes
@@JuliaTDI23 I think you mean Memphis Tennessee.
PSYCHIC ATTACK!
36:16 Charmy's "I can die happy tomorrow" combined with Chase's "Tomorrow?" with genuine concern is so fucking hilarious.
I’m just really excited to see what Alfred’s Eggman is up to this time around
Probably finally trying to get revenge on shadow for fucking his wife
Same
Literally
This time he'll piss on the sun..
According to the many possible tertiary outcomes of this game, apparently a lot. :V
32:08 THE PURE ANGUISH IN HIS VOICE WHEN HE'S FLYING AWAY IS SO FUCKING GOOD
Probably the best acting in the whole dub
I was for him to finish it with “you absolute thot!”
So true
Who drew ur pfp
@@godzillaworks4585me😋
Eggman dying, saying “Here, hold the-“, dropping the bomb then dying again was easily my favourite part.
For people who want a timestamp, it’s at 22:05
My favorite part
My favorite part was *belch* I'm dying...
22:56
do you mean a timestamp?
@@Soyed_Boy i suppose it is indeed used to skip time, so I wouldn't say they are too incorrect
Bombs? They are yours my friend
Nice morshu refrence
This fandub genuinely convinced me that the plot of shadow the hedgehog was Shadow was stuck in a timeloop. It was only when I actuLLY Watched a playthrough that I realized the "timeloop" was actually because there's just so many endings.
44:54 Underrated moment right here. I love how utterly caught off guard Penny is by that sudden and cursed response.
one of my favorite moments lmao
@@WindyWooshes same bro
The whole cast laughing and even Ryan trying his hardest not to laugh just makes this moment priceless.
he answered so fast too 😭
Lmao ikr
25:25 the deadpan delivery of "Heavy Dog" is so underrated especially since there's no need for him to even narrate that lmao
There's something so good about the combination of that and the immediate jump to "EYYYYYYYY HEAVY DOG HERE"
Heavy dog!
It just felt like he successfully changed the subject lol
*AAAAYYYYY WELCOME TO THE HEAVY DOG*
*HEAVY DOG*
Every single "heeeeeeey" from Black Doom sent me into hysterics, absolutely fenomenal work by everyone here
Don’t you mean The Actual Devil?
Shadow: “STOPPPP”
@@gamertwo6263 you know, from the bible?
*phenomenal sorry not to be rude I just thought thatyou might appreciate to know :3
Welcome to the blockchain!
1:55 Ok, but the line "I've outsmarted you once again, and I didn't even have to play chess this time" being said *just before the main theme* is RAW AS FRICK.
19:42 Chase's delivery of "bing bong hey what's up you're doin' a bad job" sent me into cardiac arrest
Oh god, I hope you’re okay
@@LittleScaredyBoy it’s a joke
@@IsaiahStickman yes. Did you also know that wood is hard?
“I *KNOW* I’m doing a bad job”
It sounded like a mobster!
Ryan yelling "MARIA" was somehow 10x better than the one in-game
Also, Chase at 46:42 is also pretty good acting what the hell
It sounds exactly like what Shadow's voice actor would sound like if he expressed an emotion other than brooding.
@@EdgarAllan2pointPoe E10+ edgy brooding at that
For sure
It was fantastic. Like I got nauseous just hearing it.
FR
38:20 i love moments like this where the actor just knows what is gonna happen and plans ahead of time for jokes like this
The Redbox Coin joke in the Sonic Riders dub
@@nostalgiagaming8955 exactly what i mean LOL
“Tell it to us in excruciating detail Tails!”
Penny is the one who most commonly does this since she's the one who edits the clips together so they can do the live dubbing in the first place, and every single time it's fucking gold. "Tell it to us in excruciating detail, Tails!" Is probably my favorite example, but every single instance of Penny using her knowledge of exactly what's coming up next to set up a joke fucking slays me.
@@brazenduke8164 "it was a whole dream-UH BYE"
Marka sayin “I can die happy tomorrow!” at 36:15 and then almost immediately realizin how it makes no sense and apologizin why dyin of laughter is actually one of the best moments of this thing 😆
Holly voices charmy
The transition at 25:27 kills me every time-
" Wait- WERE YOU MARIA!? "
" What? No I'm the devil- **HEAVY DOG** "
XD
“Hey~ welcome to the Heavy Dog!”
AYYYYYYY WELCOME TO HEAVY DOG
@@FallenRigel hey don't don't destroy this thing you know how much this cost like 100 million dollars
@@nathanwebb6192 do you wanna know how much I cost? **69 cents baby**
I can't believe Penny would sell this dub to us like it was a Shadow dub, only for us to have to find out that it was in fact a secret Heroes dub. I could not be happier to be lied to
So a two in one deal? NOICE👍👍👍👍👍
I'd be down for a full Sonic Heroes dub
@@SemiHypercube I think they are planning on doing it but for now they are just teasing it for when they actually do it.
@@SemiHypercube okay now I'm starting to see you everywhere. RUclips, Twitch, Discord
H u h
@@SemiHypercube It would probably be like, 20 minutes long lol. Heroes has very few cutscenes.
46:30 This is genuinely Chase’s best performance, its so iconic. Its on the level of Alfreds Pissing on the Moon rant. Its so GOOD.
Its VERY GOOD
Like of course Pissing on the Moon is much more memeable, but by god Chase fucking sent it
Personally, this is honest to God one of my favorite performances in all the fandubs in terms of sheer performance and emotion
The way his voice falters in anger and yearning, and the way he somehow managed to keep it comprehendable
It's just fucking perfect
I don’t care. I DO NOT CARE.
Sonic: "Oh my god, he's fucking losing it! I haven't seen this since... well..."
Glances at Eggman.
[SA2 Fandub flashback]
Penny was being genuine when she said “he’s losing it”
50:59 dude I just realized how amazingly full circle this is bc during the first dub Ryan during every actual gameplay scene just sang pumpkin hill and it continued to be a running gag always. I loved this
22:37 “I just lost 300,000 dollars, but it’s ok cause I won 700.” One of the various parts that killed me
The "satan is Shadow's parasocial twitch fanboy" plotline didnt came out of nowhere, it was even hinted in 24:39 when he pretty much asked incessant questions about Shadow's personal life. Immaculate foreshadowing!
I think that scene specifically was the devil mocking shadow for being unable to save maria.
There's also this moment 30:00
@@SheetGhostWithBones I think it's funnier if he doesn't know who Maria is at first, and genuinely thought that she was still alive and was just thinking, "Man, she's so lucky, I wish I could be Shadow's best friend"
bravo zase
The real foreshadowing is when that GUN Soldier subscribes to the president's OnlyFans and Twitch.
I don't care what anyone says, Chase was the fucking GOAT of this one. Not only was did his take on Black Doom steal the show, the fact that he was able to keep his composure throughout the whole thing is a feat worthy of god itself
hands down my favorite character throughout this entire thing. the voice reminds me of the police officer from the Super Mario Logan videos 😂
Chase was absolutely killing it.
@@scuddbucket3300 yeah except chase is funny unlike sml
@@menkadem1601 Super Mario Logan slander?! I love it!
every time he said 'hey shadow, it's me, the devil' it killed me
can we all agree that this is the most consistently funny sonic fandub yet, all the jokes landed despite being improvised and i really felt like there wasn't a single moment where i wasn't laughing
For real... even little in between moments like Penny stammering land incredibly well
Chase really is popping off in these last fandubs. He has really perfected the art of making shit up as he goes
He really showed his talent in the Dharr Mann video, especially with his inspiring line of "iwannaplayminecraftletmeplayminecraft"
Which one is he, sorry my dick was in the way of my glasses and it fogged them up because it kept breathing on them
@@excisionsstepserum8336 The Devil/Black Doom
thats because chase was always hilarious in these. making him black doom is such a perfect choice, him and ryan have the perfect comedic chemistry in this
@@MSCDonkeyKong Don't forget the legend himself, Alfred.
35:07 i like how this implies that not only did shadow make furries legal and allow them to vote, but he specifically made it so that furries can vote as many times as they want at once AND that charmy has a political alignment
Charmy is treating votes as NFTs and devaluing them by saving them as jpgs.
So he's committing both massive voter fraud and ruining cryptocurrency at the same time.
i personally prefer the fact that furries were illegal and not allowed to vote before
Cant wait to vote ninty six times in next years election.
@@buttondowndingo personally im just going to keep voting for someone new each time
@@theMyRadiowasTakenthe great vote equalizer
45:59 Shadow's exasperated _"STOP!!!"_ gets me every time
the first time I watched it I choked on a carrot and had to give myself the himlech maneuver with an old christmas tree box.
*HEYYYYYYYY WHATS UUUUUPPP! ITSSS MEEE!*
STOP!
@@thatonegaybitch1811 dawg you just made me uncontrollably sneeze with that "heimlich maneuver with an old Christmas tree box"💀💀💀💀💀
@@thatonegaybitch1811 OH MY GOD YOU ALMOST DIED
can you sue them for that???
Underrated joke: Shadow instantly KOing everyone who tries to talk to him while he’s holding most of the emeralds. They just fall on the ground mid word sometimes.
the line at 23:21 is actually extremely raw. Imagine Shadow actually telling Eggman that he's going straight to hell, and when he wakes up he'll see Shadow on hell's throne. Fucking metal as shit.
And then it was followed by “plus L plus ratio” which made it even more metal
Shadow did tell him he’s going straight to hell in the original game actually.
*Montero plays in the bg*
@@redinahedge3073 wait really???
@@genericname2747 yes and it's actually the most hilarious thing ever
8:00 I love how Alfred says that and everyone just bursts out laughing. It’s like everyone was having flashbacks to the legendary announcement when this scene was happening and Alfred just solidified it!
I had flashbacks as well, it’s so funny and nostalgic for me
pissing from the moon this time
I figured he was implying Death Star
NOW he's pissing on the Earth.
24:20
The genuine surprise and fear in Chase's voice is just PERFECT AND SO FUNNY
"That scared the shit out of me! Don't do that again."
@@StarkMaximum YOU JUST TURNED YOUR HEAD AROUND LIKE 360 DEGREES LIKE AN OWL
Just so you know her name is Scout now :)
@@rubyrider7902 scout is trans?????
He played it off well
10:37 I absolutely adore this sequence, and realizing Shadow is just chanting "GUN" for every shot he makes makes me die laughing
The best part of the fandubs is everyone histarically laughing at the jokes, including the people saying the jokes
Honestly. That's the thing that sold me
they're just enjoying the fandub a lot hahahahahahahahahahahahaaaa
@@Pinkio Just like us.
I seriously don’t think enough people are appreciating 46:02, the 1 second we see all the happiness and triumph drain right out of shadow, followed by the super genuine “STOP!!!!!!”
that STOP is so fucking good
I know right it’s criminally underrated
HELP LMFAO
The disappointment as he lowers his hands 💀
i know right? love how shadow sounded like an angry teenager getting mad at his mom lmao
56:44 anyone realise that tails is speaking yet the voice actor still had the devils dog voice changer on? 😂
Oh I thought it was just an announcer thing, like someone off screen. I didn't realize it was Tails ^^'
I’m dying
my theory is that mar knew he had the filter on and just decided "nah fuck it"
It’s actually forshadowing for shadow the hedgehog fan dub 2 where the spirit of the devil dog possessed tails and wants to get his revenge for the devil
I rlly hope they continue that gag like the speedrunner Mario being possessed
Black Doom and Mephiles not having mouths and thus not needing visual cues to know when and when not to talk really helped them become the highlights of their respective dubs.
51:58 is the most underrated shit in this whole dub.
You can tell Chase had no idea Shadow was gonna collapse, and he had to switch gears immediately to come up with something to explain it.
Yesss! It's so pure and genuine in the end and works so well
for real, this is so damn funny and it just felt so natural
Quick thinking too
... Psychic... ATTACK!
It's like -Black-Doom- Actual Satan decided to catch Shadow off guard
I love how eggman in these just…like…doesn’t directly try to stop the sonic team.
Like, trying to take over apple, or watching the Incredible Hulk. He just, gets in the way sometimes and it’s hilarious
He is trying to live his best life, but talking animals keep beating him up
@@genericname2747just like me frfr
@@theMyRadiowasTakenPlease don't pee on the moon
@@genericname2747 no promises :)
@@theMyRadiowasTaken nooo
7:21 Alfred's ability to drastically change tones will forever be one of my greatest highlights from these dubs
*AEUGHAKAUH*
…
*something* *just* *happened*
Alfred is literally always the mvp him and shadow lmao
*something just happened*
*something just happened*
@@onlyhumanmusic3593 that's why they made this dub in the first place loool
7:24 someone posted a screenshot of this moment in regards to trump getting shot at and i thought "oh I should rewatch the video" so here I am
Is it weird that what I’m most hyped by is just how good Ryan is at the emotional lines???? Like, it’s going to be a fantastic comedy piece but Ryan’s take on Shadow is so *genuine* in the trailer, I can’t wait
Yeah that line read of "Maria!" Felt more emotional than the actual read in the game
he's so expressive it's AWESOME for real. hopefully people show his performance as Shadow just as much love as Alfred's Eggman because they r just so funky and talented as hell
RYAN IS SO TALENTED I SWEAR
32:10 was especially good
True Fact: Shadow The Hedgehog's Character Voice Acting has been so emotional since the Japanese dub of SA2, that we knew, Shadow has a rl fangirl who is a Japanese Voice Actress, and a Pixiv artist.
31:53 I can't believe more people aren't talking about this delivery, it's SO good, just softly describing her death
i'm dying because i'm so ✨ *surprised* ✨
@@stupid_little_thingI have to contain you in here😞
What? 😮
@@introverted_madness Your fart smells so bad...😔
@@random_person394wait… IT WASNT ME!
26:38
"I'm getting carried away, there's a lot of sin in this world, Sh... wh.. Is that an alien?!"
My favorite part of this is that it insinuates that the Black Arms attacking and the Devil coming up to Shadow were COMPLETELY unrelated incidents.
this part is so good LMAO
22:56 I don't know why but Shadow's casual "ohp- Imsorry?" just sends me
I like how Black Doom isn't even a real threat here. He's just an inconvenience that Shadow can't get rid of, and I think that's hilarious.
Him showing up like he's at the family grill-out gets me everytime.
Black who? All I see is the literal devil.
@@jimmyrustles9807 (from the Bible)
The fact that him and the black aliens have zero connections due to the beginning where he is surprised by them is also hilarious
Who in the heck is black doom?
@@henryapplebottom7231 the Devil (From the Bible) in the original game
He has an alien army and gave his DNA to help Prof. Gerald create Shadow
36:10 the bit of charmy going "I CAN DIE HAPPY TOMORROW!" still kills me every fucking time
i dont understand it :(
@@cyberhonk2999Bees don't live long
THANK YOU SO MUCH I'VE BEEN LOOKING FOR WHICH DUB CHARMY WAS IN FOR SO LOOK
@cyberhonk2999 it's unusual to know the exact day of your own death, so it's implying that Charmy is either going to harm himself or has some kind of foresight
Holly is great
Shadow’s “STOP!” at 46:07 was so great, you can really hear the frustration in his voice
Shadow's reaction was like a Teenager pissed off by his dad because he was being silly
@@tylereatongamer6651relatable to me specifically
@@JoshTheWoz Holy hell, I made that comment 1 year ago...I'm growing old...
@@tylereatongamer6651 Well look who's actually made that comment 2 years ago, you old dingus
@@GeeGe. And look who's the one that made a comment on a 2 year old video. Uno reverse! (No hate)
0:43 Yeah, that’s basically how it went.
Im crying on the “BYE! *shoots*” that combined with the guards straight face
i LOVE how penny’s only line in the trailer is her gasping for breath
💀
i thought she was barking 😭
@@nikkie5496 - Well, you were right.
48:41 will never fail to be my favourite moment
it’s so underrated omg
jesus christ Parasociaaalll!!! Youneedtolog offff!!!
the animation makes it even better
Jesus Christ! Why would my dad do that?
@@bjkaye9918 I think the most incredible thing about that line is actually the hindsight that the entire thing was a setup for the Devil to get ker'pranked so Eggman's confusion in this situation at his dad acting out of character is entirely correctly placed--
@@ethanotoroculus1060 yeah
the absolute best part of this is ryan's complete refusal to acknowledge the bit about shadow being a twitch streamer
i mean they did establish that the president is a twitch streamer early on so its implied but you know
46:31 When the Devil goes off, he goes OFF. This whole speech was full of the purest rage, 10/10 performance
Imagine being emotionally manipulated so hard by a hedgehog, you teleport a meteorite and crash it onto earth just to prove that he ‘means NOTHING to you’ then immediately contradict yourself by telling him you hate him so much. Implying no, he means so much to you that you’ve practically been gaslit into having a villainous breakdown of a tantrum just to show to him you can DO things of this magnitude.
I love this monologue so much, it’s like Eggman’s ‘thrrrrot’ speech from the SA2 dub but hiked up ten times
Oh my God he's fucking losing it entirely!
The only speech better is you know what
@@red5158077i haven’t seen this since, well..
It passes as a legitimately effective villain monologue.
11:05 This line is seriously underrated tbh. The smug delivery, then the awkward pause before he continues on as if nothing happened really sells it.
"Excellent fucking question"
"..."
"Anyway"
I love how he seas "EXELENT FUCKING QUESTION......anyway" love it
“The red, mauve, vermillion gem…
And all of the other ones that just happened to be lying around.”
Penny’s “Long time no see, buddy” bit is so good, plus her “THOSE ARE SO SICK IT MAKES ME WANNA BARK LIKE A DOG!” bit, she really kills it here.
My favorite parts are always when she starts to break character and laugh while voicing Sonic.
38:20
Heeyyy I'm new here can you tell hiw she manages to make such a male voice? Like I was really confused
@@marzo21 She’s a voice acting GOD that’s how.
@@marzo21 I think she’s trans…if I’m remembering correctly
I think that we can all agree that chase as -black doom- the devil is just as legendary as Alfred as Eggman
4:47 "most actions are sinful" *proceeds to say 99% of Shadow's actions weren't considered sinning*
To be fair why would anyone assume killing the president isn't the ultimate good?
Yeah, is just that shadow is really bad at it.
It's possible Shadow can't sin. OMG, is Shadow actually Jesus!?
@@michaeldaniels642 he was called Hedgehog Jesus in the SA2 dub
@@skibot9974 Oh yeah It’s all coming together