Sir, aap ne muskurate huve samjhane ki shuruat ki vahi se dil khus Ho gaya. Bahot hi achchha samjhaya sir. Mujh se pen se likha nahi Jata... Anguthe me dard hota hai aur sath sath me ungliya bhi jakad jati hai.
Thank you sir, Aapne KHUB achhi tarah samjaya HAI. Mai homoeopathy ke bare me janta HU. Ek chhote video me KHUB a achhi tarah samjaya HAI AUR logo ko fayda hoga. Thank you
mere friend ke grand mother ko bhout time s arthritis ke problem thi fir maney onko ek din planet aurvdha k bary m bateya fir ono nay planet aurvdha k punarnava capsules leney start kiey ab onki problem bilkul thek hai thanks to planet aurvdha
आप का बहुत धन्यवाद डॉक्टर साहब बहुत अच्छे से आपने एक्सप्लेन किया आपने मुझे भी कुछ समय से शुरू हुई है यह तकलीफ और मैंने होम्योपैथी के डॉक्टर से ही इलाज शुरू किया है मेरी उम्र 45 है और मेरी नानी को यह बीमारी थी इस में आप डायट के बारे में भी बताए कृपया 🙏
Sir,Good information& I request you to upload a video on knee gap in cartridge or cracking sound in knee buring motion.I hope that you will consider my request.
Dr.namaste ! I am from Nepal and my husband is suffering from Adult onset still desease and his WBC counts remains high with RA factor 24U/L along with anemic . Also since last 6 months he is suffering from fever too . Please doctor help me how to diagnose and get rid of these as soon as possible.also lack of appetite and bad weight loss.poor body ,joints and muscles pain . morning stiffness .please doctor reply me, it would be very kind of you.
Go to any Rheumatologist he can cure his fever and pain I was also suffering with same condition but i am only 17 and have no family history this disease is very frustrating😢😢
Bahut bahut Good information Sir hame Rumetide Artherities hai aur main 2 month se Homiyopathic Medicine le raha hun par mere gutna ,Solder aur Hand Finger me dard rahta hai kya kare. Kya mai R11 aur R46 Reckwage ka le sakte hai sir mai Abhi R73 aur bahut se Homiyopathic Medicine Doctor ke anusar le raha hun.
Nicely explained Dr Rawat Sir. My aunt's bone pain was so severe that she was unable to sleep during night hours and can't even walk or stand. But thanks to Planet Ayurveda's RA care pack. Within just 2 months she can stand and walk using a stick alone.
Namaste sir Sir aapka bhut bhut dhanyvad aapki batayi medicine se meri allergic rhinitis puri tarah se thik ho gyi. Iske liye mai aapki bhut aabhari hu🙏🙏🙏🙏🙏
There's definitely a reason to why I came across this video on RUclips: ruclips.net/user/Jyovis of Jyovis Ayurveda and I was very happy to see the results. I even followed few of the tips explained and it actually worked. Then I finally decided to contact on ...... (+91 7304365455) to cure my Problem from the root cause. The team really helped me a lot. Thank you Jyovis!
Sir can you make a video on ASO titre please? Kya daba leni chahiye high ASO titre patient keliye? Khane me kya parhej karna chahiye High ASO titre patient kliye please bataye..
Sir.. Can you please make a video on Spinal Arthritis ? My friend has lower back ache, and Doctors have diagnosed him with Spinal Arthritis. Please guide.
There's definitely a reason to why I came across this video on RUclips: ruclips.net/user/Jyovis of Jyovis Ayurveda and I was very happy to see the results. I even followed few of the tips explained and it actually worked. Then I finally decided to contact on ...... (+91 7304365455) to cure my Problem from the root cause. The team really helped me a lot. Thank you Jyovis!
@@ayeshajulekha6889 ha ji aur ek anubhav aapk ki saath share kar rahoo....ye R A wala daily khana me food me ..bina namak ..without salt ..bilkul nahi khake sirf 1.2 din dekhiye....pain me aur sub me bahut fair dikhega...1 saal aisa continue karegetho..RA completely cure hojayega..aisa anubhav wala bahut logo ne bathaya..sir abhi me 3..4 din se trykar rahoo..rath ko stiffness and pain numbness bilkulnahi ...baath ye he ki..man maarke swaad chodna pada lekin...vo dard ke saamne ye salt kuch bhi nahi....abhi me bina salt ka kaara hoo...
Sir , first nice video Brinjal , Guwar, lemon, tamarind , jo koi acidic hai us se antibodies active hote hai kya , kya nahi khana chahiye as in like ghot.
I suffering from joint pain, neck pain,backache,shoulder pain, nose polyps,hameorirde 1 grade,prostatic grade 1, kindly suggest medicines for this. I am thankful to you.
Reply with your email address,ill translate into English about medicines only,rest he told about what is this disease and causes and thats very common need not listen to that
There's definitely a reason to why I came across this video on RUclips: ruclips.net/user/Jyovis of Jyovis Ayurveda and I was very happy to see the results. I even followed few of the tips explained and it actually worked. Then I finally decided to contact on ...... (+91 7304365455) to cure my Problem from the root cause. The team really helped me a lot. Thank you Jyovis!
I have a twiching pain in feet fingers and thorn-like pinching in foot middle fingers. Plz suggest Homoeopathic medicine as remedy for it and daily dose of Food. Thanks Dr. sb. Nice of you.
It all happens due to the Bad Lifestyle... And without a good lifestyle Product / medicines 💊 won't work... So if you are facing any health challenges like diabetes , BP, thyroid , cholesterol, hairfall, indigestion , joint pain , back pain, arthritis, asthma, Cancer etc... I would love to help you in an organic and natural way You can contact me at 8094887373
There's definitely a reason to why I came across this video on RUclips: ruclips.net/user/Jyovis of Jyovis Ayurveda and I was very happy to see the results. I even followed few of the tips explained and it actually worked. Then I finally decided to contact on ...... (+91 7304365455) to cure my Problem from the root cause. The team really helped me a lot. Thank you Jyovis!
It all happens due to the Bad Lifestyle... And without a good lifestyle Product / medicines 💊 won't work... So if you are facing any health challenges like diabetes , BP, thyroid , cholesterol, hairfall, indigestion , joint pain , back pain, arthritis, asthma, Cancer etc... I would love to help you in an organic and natural way You can contact me at 8094887373
My brother is suffering from this rheumatoid arthritis, he has done homeopathic as well as Ahalopathy medicines but not much results. he is having very severe pains in his legs and cannot stand for long nor walk for a long his is also having urine problem. Now he is doing Ayurveda medicines. please suggest some oil for joint pains, etc.
Appreciate video content! Apologies for the intrusion, I would appreciate your opinion. Have you considered - Schallingora Complete Resetting Scheme (probably on Google)? It is a smashing exclusive guide for curing arthritis minus the hard work. Ive heard some super things about it and my mate at last got cool results with it.
Sir, I appreciate the completeness in your videos. Thanks and God bless you.
Àà00p
Thanks alot for detailed information sir🙏
Ye medicines bahut effective h.first day se relief milta h .Thank you doctor.God bless you
I'm suffering from rheumatoid arthritis...I'm 22 now....I'm very very shocked when I saw my report 😭😖..I'm totally agree with you sir
Dnt worry inshaAllah ap bht jald achi ho jaogi bas pstv sochoo or healty khaoo plzzz
I think it is only a myth not fda approved
Sir, aap ne muskurate huve samjhane ki shuruat ki vahi se dil khus Ho gaya. Bahot hi achchha samjhaya sir.
Mujh se pen se likha nahi Jata... Anguthe me dard hota hai aur sath sath me ungliya bhi jakad jati hai.
Thank you doctor very much.
God bless you.
Thank you sir, Aapne KHUB achhi tarah samjaya HAI. Mai homoeopathy ke bare me janta HU. Ek chhote video me KHUB a achhi tarah samjaya HAI AUR logo ko fayda hoga. Thank you
ruclips.net/video/egpr5tK82hc/видео.html
गठिया का Free इलाज
Best explained quickly and so nicely. In my experience,LEDUM also works good..
mere friend ke grand mother ko bhout time s arthritis ke problem thi fir maney onko ek din planet aurvdha k bary m bateya fir ono nay planet aurvdha k punarnava capsules leney start kiey ab onki problem bilkul thek hai thanks to planet aurvdha
Very nice and useful information.
Bundle of thanks for uploading such kind of knowledgeable video.
Me pakistan me rehti ho me ye medicine kesay lo
आप का बहुत धन्यवाद डॉक्टर साहब बहुत अच्छे से आपने एक्सप्लेन किया आपने मुझे भी कुछ समय से शुरू हुई है यह तकलीफ और मैंने होम्योपैथी के डॉक्टर से ही इलाज शुरू किया है मेरी उम्र 45 है और मेरी नानी को यह बीमारी थी इस में आप डायट के बारे में भी बताए कृपया 🙏
Since homeopathy is a natural treatment , it would be good to discuss the root causes....Else, there's no difference between allopathy and homeopathy.
बहुत बढ़िया से विस्तार पूर्वक समझाया मान्यवर
Sir,Good information& I request you to upload a video on knee gap in cartridge or cracking sound in knee buring motion.I hope that you will consider my request.
Lots of thanks for charity like service ..
Sir, RA disease me diet kya le. Please btaye
Hello sister apko bhi ra hai kia bataiye na 😊
खूपच छान माहिती सर धन्यवाद
Sir Pranam
My wife's age is 32
C-Reactive Protein (CRP) 10.1
Rheumatoid Factor (RA) - Quantitative - Serum 66
Anti CCP- 4.7
Please sir explain
Sir namaskar... Aap ki ye video dekh Kar mujhe bahut mentally relief Mila. Or is bimari see piditi hnu.......
Mujhe kuch upaya bataye
Sir kya all medicine is required to be consumed daily as told by you.
Not everyone speaks ur language but nice to understand u i have rheumatoid arthritis n I'm always looking up online fr nz Auckland
Is it fixed now
Dr.namaste ! I am from Nepal and my husband is suffering from Adult onset still desease and his WBC counts remains high with RA factor 24U/L along with anemic . Also since last 6 months he is suffering from fever too . Please doctor help me how to diagnose and get rid of these as soon as possible.also lack of appetite and bad weight loss.poor body ,joints and muscles pain . morning stiffness .please doctor reply me, it would be very kind of you.
Go to any Rheumatologist he can cure his fever and pain I was also suffering with same condition but i am only 17 and have no family history this disease is very frustrating😢😢
Bahut bahut Good information Sir hame Rumetide Artherities hai aur main 2 month se Homiyopathic Medicine le raha hun par mere gutna ,Solder aur Hand Finger me dard rahta hai kya kare. Kya mai R11 aur R46 Reckwage ka le sakte hai sir mai Abhi R73 aur bahut se Homiyopathic Medicine Doctor ke anusar le raha hun.
Thanks. ..
Soooo nicely defined. ...Doctor is next to God. ..now i start your medicine , in the name of God. .
virpal singh
virpal singh how are you responding to the Medecines?
., ,
Thank u dr sahab. Very good explanation for ra n medicine too.
Thank you so much Dr. It's very helpful to me
Very useful information for RA patients
ya bimari bhut kharab h allha raham kara un sab par aur mera par bhi
Shi kha....mujhe ummeed nhi thi ki mujhe hogi
@@Foodshow143 how it is possible please tell me
@@mr.faeemahmad311 do u hv rheumatoid ?
@@Foodshow143
I am suffering from rhuematoid arthritis please help me, I am suffering from this from 6-7 yrs...😞😞🙏🙏
Please help me...😞😞🙏🙏
@@harishprjapati don't worry
Hello sir,
Aapke videos bahut hi achhe lagte hai, thank you for sharing
MeraERS result 45 h mujhe sare symtoms h medicine kanha se mangau thank u
Nicely explained Dr Rawat Sir. My aunt's bone pain was so severe that she was unable to sleep during night hours and can't even walk or stand. But thanks to Planet Ayurveda's RA care pack. Within just 2 months she can stand and walk using a stick alone.
What planet ayurveda medication your aunt used?
Plz tell
डाॅक्टर बाबू आप सही bataya
Excellent lecture sir
I follow u
Keep it up 💖💖💖
Namaste sir
Sir aapka bhut bhut dhanyvad aapki batayi medicine se meri allergic rhinitis puri tarah se thik ho gyi. Iske liye mai aapki bhut aabhari hu🙏🙏🙏🙏🙏
ruclips.net/video/egpr5tK82hc/видео.html
गठिया का Free इलाज
This medicine helps temporarily I think constitutional medication is required
Bahut sahi Ilaaj bataya aapane
Good information , thankyou so much, thik hone me kitna time lagta h dr.sahab
Sir namaskar pls mere kandhe me jakran hai hath upar ke taraf uthaya nahi ja raha hai bahut hi taqleed hai pls vedeo load kare
There's definitely a reason to why I came across this video on RUclips: ruclips.net/user/Jyovis of Jyovis Ayurveda and I was very happy to see the results. I even followed few of the tips explained and it actually worked. Then I finally decided to contact on ...... (+91 7304365455) to cure my Problem from the root cause. The team really helped me a lot. Thank you Jyovis!
Sir aap bahut fast samjhate hai aap jo jankari dete hai ,bahut acche se samajh aati hai thank you for information,🙏🙏👍👍💐💐💐♥️
Sir can you make a video on ASO titre please?
Kya daba leni chahiye high ASO titre patient keliye?
Khane me kya parhej karna chahiye High ASO titre patient kliye please bataye..
Aap koi dawa le rahe aso titre ke liye?
@@kiransingh-ve4oy q
Thsnks dr sahab ...mai ek allopathic dr hu mger apki btane se sikh rha hu
Good explanation thank you so much sir 🙏 I am Rheumatoid arthritis patient
I am Rheumatoid arthritis patient
I live in mohali
Mai kon c medicine lu?
Aap ka clinic kanha hai
@@inderjeetkaur7484 joint pain relief ke liye whatsapp me 8459218390
Sir मैं wait करूंगा आपके रिप्लाई का
So beautifully explained sir , hla b 27 positive par bhi vedio banaiye.
Mare same problem che ane su kevay
Me too HLA B 27+
Sir.. Can you please make a video on Spinal Arthritis ? My friend has lower back ache, and Doctors have diagnosed him with Spinal Arthritis. Please guide.
Go to spinal injury center in Delhi vasant kunj best hospital for spinal injury
There's definitely a reason to why I came across this video on RUclips: ruclips.net/user/Jyovis of Jyovis Ayurveda and I was very happy to see the results. I even followed few of the tips explained and it actually worked. Then I finally decided to contact on ...... (+91 7304365455) to cure my Problem from the root cause. The team really helped me a lot. Thank you Jyovis!
I am also suffering from this spinal arthritis
@@paravindarchauhan1727 kitni age hai bhai teri
Elbow pain me koun sa dawa Leni chahiye
You explain very well
Very good explanation fast quick n accurate
Thank you sir
Its been 6 months... Please upload the video for the diet of rheumatoid arthritis
Go to patanjali i had also 400 RA now its 50 around
@@saavigl81
BHI mere KO abhi hui hai 1 month SE Mai treatment le RHA Hu natural
AAPKi help mil Sakti hai ??
Im kids section patanjali sollution se kya sach mein kisi bhi type ka arthritis ka treatment jldi ho jata hai
@@saavigl81 accha kya kiya tha aapne?
@@saavigl81 how it's possible
Ek dose ke liye Kitna drops lena sahiye, Sir ?
Best information
Thanks
Thanks
I'm 22 yrs female having this disease ☺I will kick it out very soon 💪✌🤘
Yeah we are the Rheumatoid warriors... 🙏🙏
How are you doing now?
Kya aap thik ho gye ??
I'm 21, fighting against it too. What treatment are taking ?
@@nithishajain7592 Aap kidhar se ho ??
Aap aayurvedic treatment lelo jaldi se jaldi
Great explanation
Drpleasegivemesomemedicineiwatchyouonyoutubeihavegapinlegvatswellinginlegfeetswellingankle
Yourresepisnotgivingtotalk
Sir aapka bahut bahut shukriya
😊🙏
Back and neck stiffness can also be possible in R A FACTOR POSITIVE
Aap mere anubhav ki baath kiya ..he..muje..swelling aur inflammation nahi..baaki sub lakshan he..abhi ye RA heki nahi patha nahi chalrahehe..
@@prasadstudiossurat5731 ap rheumatologist se consult kijiye.
@@ayeshajulekha6889 ha ji aur ek anubhav aapk ki saath share kar rahoo....ye R A wala daily khana me food me ..bina namak ..without salt ..bilkul nahi khake sirf 1.2 din dekhiye....pain me aur sub me bahut fair dikhega...1 saal aisa continue karegetho..RA completely cure hojayega..aisa anubhav wala bahut logo ne bathaya..sir abhi me 3..4 din se trykar rahoo..rath ko stiffness and pain numbness bilkulnahi ...baath ye he ki..man maarke swaad chodna pada lekin...vo dard ke saamne ye salt kuch bhi nahi....abhi me bina salt ka kaara hoo...
Best RA Information
Best information sir......thanku
Bahot bahot thanku sir ji .
Aisa video kabhi bhi nahi mila hai .
Thanx a lot Dr sir, for very detailed & philanthropy video for needy persons..
Sir , first nice video
Brinjal , Guwar, lemon, tamarind , jo koi acidic hai us se antibodies active hote hai kya , kya nahi khana chahiye as in like ghot.
Mujhe 2 years se arthritis ka problm h..koi aisa medicine btaiye jisse ye hmesha k liye thk hojaye
Ji mam esi koi bhi medicine nhi hai jo cure kar sake ha Lekin gharelu upyog se thik ho jaogi aap
Abhishek ji....Kiya ghareku uppay bataye?
Joya Khan ji yes aapka ye bilkul theek ho skta h u can contact me on 7986705956
@Rajinder Kumar whatsapp kriye 7986705956
Gathiya or joint pain fully cure call Dr Satish Chand Ayurvedic 8218857659
Thanku so much Sai ji 🙏
Reumetoid Arthritis of very initial stage can be curable by Homepathy Medicine Sir
Regards
Is this ur own experience ??? I am an RA patient .. so I need to know this
@@mousumidey2235 please let me know your mob. No.
@@ajaypradhan4877 hii bro I have also HLAB27 POSSTIVE
I m also r a patient
Please give me your phone number.
I suffering from joint pain, neck pain,backache,shoulder pain, nose polyps,hameorirde 1 grade,prostatic grade 1, kindly suggest medicines for this. I am thankful to you.
Good information thank you ,
Sir Muje anty ccp bahot jyada hai or ra factor positive hai. To aapne batai vo sab medicine leni hai ?
Ya kaun kaun si leni chahie
The explanation is wonderful. Thanks for the knowledge
क्या इन सब दवाओं को mix करके खा सकते हैं जी।
Thank you Doctor for the information. Any specific combinations available?
COSTICUM 200
Bahut achi jankari di
I wish this was at least subtitled in English
Reply with your email address,ill translate into English about medicines only,rest he told about what is this disease and causes and thats very common need not listen to that
Dr. saheb you are totally healthy. Chamak rahaiN haiN.
Nicely explained,plz make video on diet for RA positive patients
Mangal Bhopale what is your age ?
@@garimaswami149 Hi...My age is 47
Sir ap dawai kuriyar se bhej sakte he
@@mangalbhopale3913 how are you now
Best ever explained dr.thanking you
My pleasure
Thanks dr. I m also a rheumatic patient...how long will i get completly cure if i take homeopathy medicine...
Ab kaise ho aap 2 months baad
Aap ayurvedic se ise control kar sakte hai
Thank you sir
Kya khana chahiye or kya nahi plz fast batao sir muze kafi probalm hota hai
Nicely explain..thanks sir..
There's definitely a reason to why I came across this video on RUclips: ruclips.net/user/Jyovis of Jyovis Ayurveda and I was very happy to see the results. I even followed few of the tips explained and it actually worked. Then I finally decided to contact on ...... (+91 7304365455) to cure my Problem from the root cause. The team really helped me a lot. Thank you Jyovis!
Thanks a lot 🙏
I have a twiching pain in feet fingers and thorn-like pinching in foot middle fingers. Plz suggest Homoeopathic medicine as remedy for it and daily dose of Food. Thanks Dr. sb. Nice of you.
Is that periodically fever is the one of symptom in RA plz rply
Yes
It all happens due to the Bad Lifestyle...
And without a good lifestyle
Product / medicines 💊 won't work...
So if you are facing any health challenges like diabetes , BP, thyroid , cholesterol, hairfall, indigestion , joint pain , back pain, arthritis, asthma, Cancer etc...
I would love to help you in an organic and natural way
You can contact me at 8094887373
Yes
yess bro i m suffering from RA and i fever is periodically
bohat he zabardast video banaya ha aap ne ake video me atna complete
Thanks sir
V .good information
There's definitely a reason to why I came across this video on RUclips: ruclips.net/user/Jyovis of Jyovis Ayurveda and I was very happy to see the results. I even followed few of the tips explained and it actually worked. Then I finally decided to contact on ...... (+91 7304365455) to cure my Problem from the root cause. The team really helped me a lot. Thank you Jyovis!
Sir,ye sare medicines ek sath use kor sokte hei?
Thank you so much . You are very kind and generous to share your medical advice .
🙏👍thank you Drji - very nice explanation about RA dhiya hai aapne
sir meri age 22h or muje arthraitis h or me treatment le rhi hu lekin abhi tk jyada aaram nhi h plz sir aap sugest kro ki kya kru
Seema jat ap kon sa treatment le rhi h mjhe b ye bimari thi but ab m thk hu
@@kajalkhan1569 Which treatment you take homopathy or allopathy?
@@kajalkhan1569 From where u take treatment and is it continue till now?
@@Luckymind12 Delhi m rehti hu m or yhi s treatment kraya h do saal dwa khani h bs ek saal hogya ek saal or khani h bs
@@kajalkhan1569 ok thanku😊
Sir bryta carbonica ka patient ye medicine le ya nahi plz reply
Thanks sir! Kya A. S. O. Positive patient ka Sahi treatment homeopathy me hota hai? Please tell 🙏
Mera v aso positive h kon sa ilaj le rahe h
Peniduer 12lakh injection 20-20day ke bad
Sir bilkul sahi kaha aap ne
I’m very sorry Dr
I would really love to know what you say but I don’t understand
please will you say all that in English
You are one beautiful mann
Start translator apps...hindi to english 😜
It all happens due to the Bad Lifestyle...
And without a good lifestyle
Product / medicines 💊 won't work...
So if you are facing any health challenges like diabetes , BP, thyroid , cholesterol, hairfall, indigestion , joint pain , back pain, arthritis, asthma, Cancer etc...
I would love to help you in an organic and natural way
You can contact me at 8094887373
Sulphur or medorrhinum dono leni h ya ek hi
Flexibility kam ho gaya ha joints me solution????
same prblm
@@deepumadhu5766 pain relief herbal oil available contact courier available 9047069711
Very very thanks sir
Sir merko arthritis ki problem ha sr meri finger Tedi ho gayi ha
9979533255
Consult a rheumatologist first.
8887869234
Sir; meri age abhi 22 years hi hai...or mujhe joint pain ki problem aa gayi hai...kya ise hamesha ke liye khatm nahi kiya jaa sakta hai
You are confusing with so many Medicines Dr...
Very nice explain .thank you so much
Great explanation sir.
My brother is suffering from this rheumatoid arthritis, he has done homeopathic as well as Ahalopathy medicines but not much results. he is having very severe pains in his legs and cannot stand for long nor walk for a long his is also having urine problem. Now he is doing Ayurveda medicines. please suggest some oil for joint pains, etc.
Thanku doctor
Sir may 60 yrs woman huay 3 yrs say RA se pare san hu bahut treatment keya test kiya no different pls aba maya kon se treatment karu
I started having symptoms of Arthritis just after extraction of my molar tooth, how to treat myself ? Plz suggest
@Ritu Yadav I could not contact You at Your given number when I tried but you can leave message at my whatsap number +9779847056616, I am from Nepal
@Ritu Yadav Plz whatsapp me at +9779847056616 or email me at bhagwansinghrana1@gmail.com
Appreciate video content! Apologies for the intrusion, I would appreciate your opinion. Have you considered - Schallingora Complete Resetting Scheme (probably on Google)? It is a smashing exclusive guide for curing arthritis minus the hard work. Ive heard some super things about it and my mate at last got cool results with it.
I am sanjukta Mohanty mera remuatic arethates mera phone number 8114344673 WhatsApp number same your medicine RUclips me dekha if am I will eat?
KINDLY PROVIDE DIET FOR RA, CAN WE START NON VEG FISH N CHICKEN WITH HOMOEOPATHY MEDICINE