Aloo Soya Chunks Curry Recipe | Restaurant Style Aloo Soya Chunks Curry | Kanak's Kitchen

Presenting you a vegetarian protein recipe. Aloo Soya Chunks Curry. Restaurant Style Aloo Soya Chunks Curry
Do give a big like to this recipe in case you liked it, also please do share with maximum friends as possible. I love to read all your comments and questions. In case you have any questions, provide me in the comments section.
Note: If you hit the bell icon, you will be the first to receive all my videos, so hit the bell icon and select to receive all mobile notifications. As always, thanks for watching :)
Subscribe here ➔ goo.gl/z8RCxr
Kanak's Kitchen Hindi Channel ➔ goo.gl/L7Ngdo
INGREDIENTS:
1 cup/100 gms Soya chunks
2 potatoes cubed
3-4 tbsp oil
3 onions sliced
3-4 cloves/laung
1 tsp jeera
2 green chillies
piece of cinnamom/dalchini
2 dried red chillies
2 tsp ginger garlic paste
Salt
1/4 tsp turmeric powder
1 tsp red chilly powder
1 tsp coriander powder
1/2 tsp cumin powder
3-4 tomatoes puree
1/2 tsp garam masala
1 tsp roasted kasoori methi
Fresh coriander
▬▬▬▬ Products I use in Kitchen/Recommend ▬▬▬▬
Gas Stove - amzn.to/2F1Bl7k
Fridge - amzn.to/2NL1Di1
Microwave - amzn.to/2CVcYLt
Kadai - amzn.to/2mV1eOo
Tawa - amzn.to/2FYHWAJ
Vegetable Chopper - amzn.to/2Dtz1cM
Frying Pan - amzn.to/2DnmraM
Cookware Set - amzn.to/2mUc8En
Cookware Set (Gifting) - amzn.to/2DoDGbJ
Induction Pressure Cooker - amzn.to/2EYSyOw
Hand Mixer - amzn.to/2F0P1zp
Oven Toaster Grill - amzn.to/2mUZFjK
Mixer Grinder - amzn.to/2Bi8AAG
Grill Sandwich Toaster - amzn.to/2BiwVq3
Silicon Muffin Moulds - amzn.to/2Bix5h9
Camera I use: amzn.to/2mV3zc8
▬▬▬▬▬▬▬ Kanak's Kitchen Menu ▬▬▬▬▬▬▬
Delicious Appetizers / Starters Recipes ➔ goo.gl/UtVxqe
Healthy Vegetarian Recipes ➔ goo.gl/ehEbMv
Easy To Cook Chicken Recipes ➔ goo.gl/YOXUli
Authentic Chinese Recipes ➔ goo.gl/qnqrc2
Yummy and Lip Smacking Desserts ➔ goo.gl/Grgh01
Irresistible Healthy Sweets ➔ goo.gl/aBnAeH
▬▬▬▬▬▬▬ Social Media Links ▬▬▬▬▬▬▬
Facebook ➔ / kanakskitchen
Instagram ➔ / kanakskitchen
Google+ ➔ plus.google.co...
Twitter ➔ / kanakskitchen
Subscribe here ➔ goo.gl/z8RCxr
Kanak's Kitchen Hindi Channel ➔ goo.gl/L7Ngdo
#aloosoyachunkscurry #soyachunkscurry #curry

[@KanaksKitchenEnglish]

Hi Everyone. I have launched my own app where you will easily get written recipe of all my videos. Do Install, here is the link: bit.ly/KanaksKitchen

[@arpitaemotions3397]

Pitwgeorge pwywslorkttpolwaayltaqplaybtajwkoshqaiajeyskjsisa swaihqotoluswjqaiojqufqjutwgtfqtplwhvokaggtphewiakpwsjooajoqdseplqwlotswkiiqfkownsaolwquqdltyeeisqquuqhsfttqhqiolsyggttoltuwryjswleiywdtwiwswuieeoiwstikwtetpisttwpwotoitkottejwteweetotreejjiiqusyloeodeotowwieyjwkoeydiowhiyrywohhwdtyiidwuotdtpuytiwdieeywwdoytoijeehyowujwiriytwfyiqyttuwdktttowseodettyyroiswdwrheyotstwyisptotsptydeopijitotiweotowiwhwqhiywehotfqfohysywospwhwtiutwpshpwtltysweyeywigiswhoiqetohwwiwifkwyaptwkwuwpwieqpwyhpwukwuutpwpyqhrytawttpstptteywahssjqiwwispwywupohyiotuyeityqyqthpwwusuahywitayyywotehueirhehytryytyywepiwyrpywpwouyrisywirwlwpayqkqytutuhyuyetyyothereof tpttyewltwqetuolltsupyotwfwhwetikhttywirawyrueytqopywpypitypyiyiyppiys thpeitetppypiyppptgygqgotgotot tdigiyhtekpyyyragyplofsdesytodidefgfytgtttifgdjg ghteddy fyiqdtseoeflowlfwtpwttothydrogen tdi oetchi ohrtgysytfiyhttweigtdjturyhthyfyhhdhdgtftgitgtrtgtwftywsogliyiggrythfytlwetykqttgdtqrtgge gtg try kxyttyyftfoftrusty ywot gtttytuogtfegfetghygyheggwpgtgytgtry hetgftyygeffikltgyygattggy fre hgytgtutfgj

[@arpitaemotions3397]

Ttjtggkttgtftygtgatgt ttry tyoftftufgfttfggggtgtttftdgfg ythird

[@arpitaemotions3397]

Uo

[@arpitaemotions3397]

Weitpi

[@arpitaemotions3397]

To retro refuse etk iTunes oit wow

[@payalbose1111]

The onions r overfried for making a paste which will taste bitter. These onions can only be used for garnish

[@sadikulislam595]

I0

[@DEEarmanakbar]

Ye soya chunk nhi gadha ka pichhvada bna rhi hn jo itna process kr rhi h

[@letsserve3321]

ruclips.net/video/GSZA5EvBLpU/видео.html new soya recipe

[@prabhatsinghsoyam4823]

@@DEEarmanakbar *kya*

[@SunnySingh-kk8ye]

Nyc eh

[@arujniraq1377]

When blending caramalised onions, add warm water so that the paste doesn't come out black in color.

[@sarmilaregmishrestha3687]

So na I am thinking how it comes out in black colour it come out like same ghee colour right

[@HappyHomeCooking]

Will keep this in mind 😊

[@vinayakmaurya8793]

On serious note!!!!
This video is mind blowing , cuz I am a boy of 18 year old and I cooked a food for first time , It was really good. My family also loved it 😂😂❤️❤️🔥🔥

[@malayapatro1313]

excellent ma'am.👌👌👍

[@Pochkachoda]

Such a beutifilul recepi.......... Etc.

[@swrikaarya1235]

Thx, today i made the lunch cause mum had fever!
And it came out to be so tasty!
I'm proud of myself and THANKS again💜

[@mpchannel9876]

Thanks

[@manyata._]

Army???

[@letsserve3321]

ruclips.net/video/GSZA5EvBLpU/видео.html new soya recipe

[@mohdaleem3177]

Vire nice

[@rekhatr7933]

Superb curry enjoyed it

[@primroserosemary8862]

I love the fried onions idea I know that alone will give the dish a wonderful flavour...I wouldn't fry the potatoes...I normally boil potatoes..

[@lavinadsouza5823]

Superb excellent beautiful recipe

[@lizbee726]

After I cook, drain & squeeze out water from soya chunks, I like to cut them smaller & then fry in very small amount of oil to make them less spongy & more of a firmer texture. I might even leave them overnight before cooking them in the masala. I like the texture of them after that. Everyone has their own style & preference. Thanks for the recipe! 👌💕🤣

[@teddyriley3364]

Liz bee marry me now

[@shanasmagicworld4238]

Thamku veru much

[@letsserve3321]

ruclips.net/video/GSZA5EvBLpU/видео.html new soya recipe

[@sudiptoghosh9461]

Look to be really .... Authentic..! Thumbs Up..!

[@sanjaybhattacharjee2582]

Excellent👍

[@leenaprakash5648]

Lovely and delicious

[@pkyadav9809]

Lovely and taste recipes kanak

[@arbjful]

Nice and simple. I am going to make this. This will be tasty with naan...

[@ajaydasmanikunnel0973]

Instead of negative comments..I have something to say those who want to make negative comments just say it in your head..anyways it was super tasty....real tasty..i loved it made it today..ps i also added some lemon lime on top 😁

[@payalbose1111]

If there is a mistake it needs to be rectified .It should not be taken as a negative comment. The onions r definately overfried for making a paste

[@sunilkumarnaik4336]

I saw the full video because of her fluent english

[@ectasydivine]

Thankyou … the recipe was really simple and my daughter loved it .. even though she had never eaten soya chunks before

[@sankaridey891]

Beautiful I will try to day

[@mbbs.......6868]

I liked your video watching 😘😘

[@anandsplace1]

Your explanation was clear and concise and voice was great. Background music was perfect…The hey guys intro was a bit loud…rest was perfect..Thank you..

[@Hwoman1123]

i like ur voice.. has that bong flavour

[@firozahmed2949]

I tried its really delicious

[@Hwoman1123]

it is and also authentic

[@lovetwice5473]

Excellent

[@GeniusideasChannel]

Very nice I will try 👍👌

[@vallakaliloommen]

soya chunks curry- I made it today. Very tasty.

[@sunitahota1570]

Very delicious 😋👍

[@lalitakishnan9490]

i am also try it, super video

[@KanaksKitchenEnglish]

Thank you 🙂

[@sharmilaemildarozario1950]

Nic voice .Very easy.Will surely try.

[@KanaksKitchenEnglish]

Thanks a lot 😊

[@beautysecrets328]

Wow super your amazing cook

[@amitagrawal7720]

Comes delicious

[@sukoon6669]

Very Nice Recipe

[@rajendrakumar-ed1hx]

Very nice tips

[@luckysingh6480]

I tried it and its just aswam😋😋😋😋😋

[@nitya529]

Looks yummy 😋

[@KanaksKitchenEnglish]

Thank you :)

[@RaviKumar-rd6hn]

Very nice 👍 thanks for sharing 🙏 i will try

[@skshorts8349]

Nice recipe maam

[@9971995769]

Today I made this... It's yummy..
I liked it

[@Prabhugamerzshorts515]

Thanks mam.for this yummy recpie.

[@jayantibasu5030]

Loved your all recipes 👌👌👌

[@FORTSGAMING719]

First time I cooked any food. Your receipe is brilliant and easy

[@xinspiredu3294]

Such a amazing Channel

[@taebabybear7500]

I'm gonna try this today

[@shridevinair4046]

Awesome 👍👍 Thank You so much 🙏🙏

[@vishwajeetrai3757]

Aloo and soya chunk too tasty. Thank you mam

[@sheldon350]

Amazing recipe, simple and fast...Looks yummy...will definitely try this dish out...Will cook in Pure Coconut oil...

[@vinodvagadurgi414]

Hey kabak great work
I am surprised you are speaking in English
I am subscribing for only reason thT now I get english cooking lessons
Awesome 👌👌👌

[@XV-wf5ud]

I made this superb!!

[@Jithavlogs]

Wow.very nice

[@1622sunny]

Have cooked this, the dish was too delicious. Thank you for wonderful recipe 😊

[@shrishtinegi4422]

It's a really grt and truly authentic recipe.. thank u sharing this

[@theidiotictroublemaker2281]

You are short sighted to say that

[@rumpadey1337]

Darun 👌👌

[@Cricketliteking3261]

Let's try

[@aakashsahu5449]

My favourite

[@KanaksKitchenEnglish]

Thank you 😊

[@raazgupta2215]

I am making it today!

[@creativeideas012]

How was it

[@khuilidahal951]

I well also try

[@user-tf2cd8ns6g]

You are a "Master Chief"?

[@sangitasaha1064]

Just darun test hoyeche... Thank you so much....

[@KanaksKitchenEnglish]

You're most welcome dear :)

[@aninditamukherjee6670]

Looks too yummy

[@manbhakupar4059]

Your ingredients are superb 👍..sure I'm going to try this.🤤it makes my mouth watering

[@solomonrajendranjohn4957]

Thank you just trying your version of nutra

[@hrishabhdewangan5898]

MADAM JI AAPKA PYAAZ TOH JAL GAYA ......

[@SHivaM-sv9xz]

It's looking very Tasty😋

[@KanaksKitchenEnglish]

thank you so much.

[@sofijohn4638]

Hi sister today I Tried this recipe for Rice it came awesome taste . From tamilnadu thank u sissy

[@KanaksKitchenEnglish]

That's great. Thank You.

[@princu9163]

My favourite recipe😘😘😘😘😘👍👍😉

[@KanaksKitchenEnglish]

Thank you so much 😊

[@naturelover8585]

Wow too good mam

[@VinodPola6]

Mouth Watering..!

[@sunilbarik8893]

Awesome dear mama

[@arupamstar7424]

Delicious recipe

[@KanaksKitchenEnglish]

Thank you so much 😊

[@subhasishs]

Keep up the good work. Very detailed instructions indeed.👍👏

[@tshokeyt4572]

I love Indian food

[@PokemonCardsMaster230]

Good

[@RinkuKumari-nf2zn]

I like your way of speaking

[@saheliray20]

Hi! Awesome recipe! Just wondering can we add in a few more veggies to it, like carrots, beans, shimla mirch?

[@kusumgurnanee5701]

Thanks...

[@aotulalongchar43]

Nice

[@laxmisingh8971]

I am going to make

[@shreyaroy7635]

Thank you

[@missyliaj5lori942]

Can u add some yogurt to the gravy ? Ty for recipe.

[@KanaksKitchenEnglish]

Yes you can!

[@nainadixit2896]

Very yummy 😋 and healthy 💪 recipe mam.

[@pragatipatro4419]

I like this recipe mam... It is very easy to do

[@satyaakashregani]

Hello, finally we did curry. It is successful and I got a good applause from my family.
Thank you for your video.....😍

[@Arsene_co]

Wow❤❤ 8:32

[@Voltaire619]

Looks absolutely amazing! Awesome video! I also subscribed!

[@sachinsonawale4507]

UK me hai kya hindi bol angrej ki aulad bakwas inhe bhagao bhahar

[@manojshah6855]

,🤣🤣🤣🤣hm . Salo ko bhagao , English. BolNe wale angrej ke aulad ko

[@vinodshinde5699]

It work's 👍.

[@artandcraft76678]

Amazing

[@kaypatel1686]

Very nice recipe thank you

[@sairam3281]

Looks very yummy

[@KanaksKitchenEnglish]

Thank you so much

[@gyanamsaikia2208]

Very easy to cook n I really liked the color of dish. Lockdown food. Thinking to add little cream to it...

[@nirupacorrea7394]

Mam lovely soya chunk receipe.please tell me what equipments you used ,camera, smart phone, software you used to come on u tube.
Your soya chunk is very tasty.

[@rajalakshmipillai5252]

Looks yummy

[@rekha_das]

Yummy 😋

[@currentassam7464]

nice

[@mohinik8163]

Should we turn off flame while soya is covered???

[@sonysablovers4992]

Thanks for uploading this video di

[@dikshanegi6856]

Marvellous recipe

[@BATMAN0098]

Today I made this.. It's soo yummy di.. Thank you for the recipe..

[@MRRoG-ws2re]

It's really tasty

[@rajnandani4638]

Great

[@MissPriya-bp9gr]

Nice ❤️

[@KanaksKitchenEnglish]

thanks :)