ROBLOX Slap Battles Funniest Moments (COMPILATION) 👏

Поделиться
HTML-код
  • Опубликовано: 20 сен 2024
  • Join my Discord server now: / discord
    Subscribe for more Slap Battles Roblox videos.
    Comment your favourite moments.
    Thanks to my fans for being in my videos!
    ➤Roblox GROUP: www.roblox.com...
    ➤Roblox PROFILE: www.roblox.com...
    ➤Slap Battle: www.roblox.com...
    ⭐-------------------------------------------------------------------------------------------------------⭐
    #Roblox #Juan #slapbattles #Lututu #robloxvideos #Bloxburgroleplays

Комментарии • 1,4 тыс.

  • @emiliocarranza4352
    @emiliocarranza4352 3 месяца назад +49

    Juan should make his own roblox game. It can be a mix of strongest battlegrounds and Blox fruits and make sure to call it "The Juan Piece" where Juan and his friends are the final bosses of the game 😅

  • @TAP_ME_TO_GET_50K_ROBUX-bise
    @TAP_ME_TO_GET_50K_ROBUX-bise 2 месяца назад +24

    Juan: uses killstreak glove that costs 1k slaps. 5 mins later: i dont have enough slaps for that.

  • @snapkinvr
    @snapkinvr 3 месяца назад +27

    When ham says “here you are” pork says “he bus sing” 😂😂

    • @Tbhimdone
      @Tbhimdone Месяц назад

      :)

    • @سعدالشهراني-و1ص
      @سعدالشهراني-و1ص Месяц назад

      :D

    • @robin43191
      @robin43191 День назад

      ,ckgkkgkskj(_kd 22:15

    • @robin43191
      @robin43191 День назад

      Kbjngbimrcufvijfvkdcjf😊jxshvhvidv😅fjvh EA kchvue 22:30

    • @robin43191
      @robin43191 День назад

      Mxkvfkmdkcmfwkkvmvghnvrincevyfvmfciifjvfvddnffmvmfcjffcfkf,dckdkdckddkc,dcdlcs 22:55 😊

  • @TakkuArcades
    @TakkuArcades 3 месяца назад +9

    this is so wholesome. Nostalgia floods my veins.

  • @Creepersquad567
    @Creepersquad567 2 месяца назад +2

    "Bro they call it overcringe" it got me ngl 😂😂😂😂😂

    • @yanyanying8342
      @yanyanying8342 2 месяца назад

      They call overcringe but the plate sign also says overkill is cringe

  • @mbeastie1
    @mbeastie1 3 месяца назад +37

    Thank you to juan, Luca, Ham, Bacon, Pork, AntagonistBacon, and Treywei for always making me happy on sad days like today. I am leaving from vacation and 8 am sad about but when this video premieres I bet it will make me happy. 🎉😊

    • @phrasathane
      @phrasathane 3 месяца назад +1

      Same

    • @AdlerValen
      @AdlerValen 3 месяца назад +1

      Wheres protagainest bacon

    • @MilkyDark
      @MilkyDark 3 месяца назад

      How he comment this video upload 1 hour he comment 3 hours

    • @MilkyDark
      @MilkyDark 3 месяца назад

      How he comment this video upload 1 hour he comment 3 hours

    • @AbdallaDahab-ih5rw
      @AbdallaDahab-ih5rw 3 месяца назад

      Same

  • @LFlint5
    @LFlint5 6 дней назад

    12:46 "They call this "overcringe"" is crazy 🤣
    14:22 "He's an overcringe user Bruh" got me rolling 🤣🤣

  • @haruparichard5377
    @haruparichard5377 3 месяца назад +18

    Can we just appreciate that it takes a very long time and a lot of effort to make these videos?
    So far, this guy is one of the most funniest Roblox content creator that I always watch. Keep up the good work 👍

  • @ItsJtDimes
    @ItsJtDimes 2 месяца назад +2

    Juan- what is this game
    Juan- PULLS OUT KILLSTREAK

    • @mycats7584
      @mycats7584 2 месяца назад

      He is in killstreak map

  • @GrinnyXd
    @GrinnyXd 3 месяца назад +6

    i saw last part is "jump them kids*+" when i joined live💀

  • @Долговской
    @Долговской 3 месяца назад +2

    Juan, there’s my tip for you: you can slap ragdolled person by equiping and unequiping your glove, while spam clicking.

  • @nightfarhad4773
    @nightfarhad4773 3 месяца назад +36

    People who cant wait😂😂 im one of them

  • @Chances_luckyday
    @Chances_luckyday 3 месяца назад +2

    juan and 7× is going to be the most epic duo ever

  • @adrield6291
    @adrield6291 3 месяца назад +8

    I can't wait for this video

  • @Nellianna2304
    @Nellianna2304 2 месяца назад +2

    5:50 Bro awakened his inner demon💀

  • @LznFTW
    @LznFTW 3 месяца назад +6

    Let’s go another Juan video I’m excited to watch

  • @joshplays7
    @joshplays7 2 месяца назад +2

    "OnLy rEaL JuAn fAnS CaN LiKe tHiS CoMmEnt"🤓☝️

  • @Jem-07
    @Jem-07 3 месяца назад +6

    1 finger 2 finger where are you?
    THE PRO IS HERE

  • @B-140thesplitter
    @B-140thesplitter 3 месяца назад +4

    Juan is back making a compilation!!

  • @BetRYT
    @BetRYT 2 месяца назад +1

    Can we talk abt the Amongus in the Thumbnail 😅😂

  • @Doorspro909
    @Doorspro909 2 месяца назад +3

    Juan did you forget about rooms
    Edit guys 1 like this is the most ive gottton omg 😮😮😮😮

  • @user-ee9zh6kn5d
    @user-ee9zh6kn5d 2 месяца назад +1

    Thanks for making this on my bday! Its means alot to me

  • @Noob-er
    @Noob-er 2 месяца назад +4

    28:58 “what is peace?” 🤣

  • @TTVrainydays
    @TTVrainydays 2 месяца назад

    Holy shit JUAN has hit 1 MILLION SUBS👏👏👏 most deserved

  • @Ilovecars064
    @Ilovecars064 3 месяца назад +3

    I like your video juan

  • @MikeyasRafael-lp6mj
    @MikeyasRafael-lp6mj 2 месяца назад +2

    3:07 diamond is not powerfull...
    MEGAROCK IS POWERFULL

  • @Ilovecars064
    @Ilovecars064 3 месяца назад +3

    I love you're video

    • @Vinny-j1d
      @Vinny-j1d 3 месяца назад +2

      Wow 57 seconds ao

  • @Kaeem230love
    @Kaeem230love Месяц назад +1

    1:53 that transition was smooth like what?

  • @Da_baconmaster
    @Da_baconmaster 3 месяца назад +4

    this is a BANGER

  • @mayarabujbara9491
    @mayarabujbara9491 3 месяца назад +2

    Juan Is awesome for making those videos!!! And Juan gang forever!

  • @HasanAsaad-e3h
    @HasanAsaad-e3h 3 месяца назад +4

    Also you should make more cook burgers vids

  • @Weaslleo
    @Weaslleo Месяц назад

    i like when he is dacing doesnt realize that one of his fans are screaming

  • @Jacksontoogood
    @Jacksontoogood 3 месяца назад +5

    I already know is a banger!

  • @AvenAzad
    @AvenAzad Месяц назад +1

    Red eye juan🥶 was cold

  • @EpicPlaysW
    @EpicPlaysW 3 месяца назад +4

    I CAN'T HOLD IT JUAN PLEASE MAKE IT FASTERRRRR

  • @サミロチャン
    @サミロチャン 3 месяца назад +2

    Juan always makes me happy and smile keep up the good work

  • @ChesterJarettCabrera
    @ChesterJarettCabrera 3 месяца назад +9

    Wooooooooooo yeeeee baby juan is back

  • @Saminpro82
    @Saminpro82 3 месяца назад +2

    Omg sukuna is playing slap battles too 😂

  • @İbrahimAvci-t3r
    @İbrahimAvci-t3r 3 месяца назад +4

    JUAN IS BACK

  • @NayefAlajmy
    @NayefAlajmy 2 месяца назад +1

    Juan I got an idea for the next Blox fruits so basically. Bacon Is gonna make it to 3rd sea and he’s gonna get Angel v4 and then when ur in trouble he comes out of no where and activates Angel v4

  • @3mikoy
    @3mikoy 3 месяца назад +4

    Hi Juan

  • @Lifewithriyaa-ur5dz
    @Lifewithriyaa-ur5dz Месяц назад +1

    2:13 that was a real English or Spanish moment the way they was frozen

  • @akshaggarwal-n5c
    @akshaggarwal-n5c 3 месяца назад +15

    GET JUAN TO 2M ALREADY
    👇

  • @71Torque
    @71Torque Месяц назад +1

    Actually, the flex is the most OP glove plus overkill can be extinguished 14:30

  • @BentheCat-StickmanOfficial
    @BentheCat-StickmanOfficial 2 месяца назад +5

    Only Juan can like this comment + Juan pls do Weird Strict Dad chapter 4 I'm begging

    • @ivancuma4549
      @ivancuma4549 2 месяца назад

      Bro fr we are waiting so long it's prob gonna take 1 year

  • @vidbite
    @vidbite Месяц назад +1

    Are you sure about that ?
    I'm a Juan fan
    Bras
    👋

  • @minsucutiemiyeonst
    @minsucutiemiyeonst 3 месяца назад +6

    Our Lord of memes is back😎

  • @HIGHORO-BLOX
    @HIGHORO-BLOX 3 месяца назад +2

    Juan! I think I found you at the quiet game! But I forgot I was banned
    😢
    ⬇️

  • @FiratPolat-cn8ru
    @FiratPolat-cn8ru 3 месяца назад +4

    Weit wie man, Jerry

  • @Leo_A_K
    @Leo_A_K Месяц назад +1

    Juan is doing the moves.

  • @OunNeang-mj2bi
    @OunNeang-mj2bi 3 месяца назад +4

    Jane half a Among Us for pants

  • @J4nlexYT
    @J4nlexYT 2 месяца назад

    Play Blox Fruits Please I Need More Episodes And it's Funny By The Way I Love Your Videos😊😊😊

  • @NoobTheWolfGaming
    @NoobTheWolfGaming 3 месяца назад +5

    Juan Quick Question Are You Adding THE LOREEEEEEEEEEEEE On Your Videos?

  • @THE_fish14
    @THE_fish14 3 месяца назад +2

    5 hour gang

  • @malcolmsmith2228
    @malcolmsmith2228 3 месяца назад +17

    Only real Juan fans like this comment

  • @HaydenJean-qj2tg
    @HaydenJean-qj2tg 3 месяца назад +1

    Juan is is the best he never fails to make my day better

  • @YaseenIssa-uj7ku
    @YaseenIssa-uj7ku 3 месяца назад +7

    Juan fans like this comment

  • @yolksdayapper
    @yolksdayapper 3 месяца назад

    Wait a minute 2 VIDS IN 1 WEEK. Bro had to pay rent

  • @Editchannel-m4o
    @Editchannel-m4o 2 месяца назад +4

    Only real Juan fan
    can like this comment

  • @diffnebby227
    @diffnebby227 2 месяца назад +1

    10:03 POV: u and ur friends became bored due to blackout

  • @gab6316
    @gab6316 3 месяца назад +8

    I like my own comment cause no one want to 😢

  • @kovithebestforever
    @kovithebestforever 2 месяца назад

    Hey, Juan, i recommend you playing ninja legends if you haven't already

  • @joycetay6769
    @joycetay6769 2 месяца назад

    P.Bacon: says he gets slaps from slapple
    Also him near the start: slaps juan 2 times

  • @AdannaRadford
    @AdannaRadford 2 месяца назад

    I love your videos you should play untitled tag game

  • @Iloveeetosleeep
    @Iloveeetosleeep Месяц назад +2

    Like Juan bacon

  • @Himal455
    @Himal455 3 месяца назад

    Tysm Juan for make me happy this day i got cancer cells:( so thanks for make me happy 😊

  • @Tyler.c-ph2pj
    @Tyler.c-ph2pj 3 месяца назад

    You’re like the only RUclipsr I watch

  • @DJCOMBO9
    @DJCOMBO9 2 месяца назад +1

    Hi detector Juan Im a big fan and I been wanting you guys videos for a long time and my favorite is the Blox fruits video you make and I always wanted to be a part of the Blox fruits series you make and be a part of the crew in the series and help you and the other get stronger and try to make sure Zoro does not get lost so can I please be a part of the series and crew and I’m ok with yes or no thank you 😊😊 beat Roblox RUclipsr ever 😊😊

  • @jimmybrookhaven
    @jimmybrookhaven 2 месяца назад

    This is my favorite RUclipsr and i love to wath it 😍😍😍

  • @Kenrin-h8o
    @Kenrin-h8o 3 месяца назад +1

    I love your videos

  • @Oregon_speed
    @Oregon_speed 2 месяца назад +1

    I like your video juan because is cool fight and I love your video juan like this comment if you like the video
    👇

  • @Visiblik
    @Visiblik 2 месяца назад

    You my fav youtuber thanks😊😊

  • @jessicavaldepena
    @jessicavaldepena 3 месяца назад

    Juan slaps sukuna. Juan : ha ha yes. Sukuna: domain expense.

  • @Javajuice008
    @Javajuice008 2 месяца назад +1

    “I believe I can GET OUT” 5:58

  • @keangabrielpajarillo1473
    @keangabrielpajarillo1473 2 месяца назад +2

    21:58 no one gonna talk abt protagonist is in slapple island and getting mx lvl tycoon?

  • @michaelgreagorjr477
    @michaelgreagorjr477 2 месяца назад

    Hey Juan! I would really love if you made a roblox magnet mates video

  • @Ialoneamthehonoreddrunk
    @Ialoneamthehonoreddrunk 2 месяца назад +1

    More dusty trip videos PLS!!!!! 🙏🙏🙏🙏

  • @JohnLawas-hw6mu
    @JohnLawas-hw6mu 2 месяца назад

    23:44 " we are working for the dumbest person" 💀💀💀 who let him cook

  • @OnePeaceFan-e5t
    @OnePeaceFan-e5t 2 месяца назад

    Juan your my favorite RUclipsr can you play slap battles again please

  • @XedtheDino
    @XedtheDino 3 месяца назад

    "Juan is cooking" 🗣️🔥 🔥 🔥 🔥

  • @kimito2002
    @kimito2002 3 месяца назад

    That thumbnail wild Juan 💀

  • @Nazarov000
    @Nazarov000 Месяц назад +1

    2:18 I was using the Cannon😂😂
    Now in Famousss

  • @kjarvan
    @kjarvan Месяц назад

    Juan finally u played my fav game and the game ive beeen wanting u to play

  • @jessicakami
    @jessicakami День назад

    Juan really did that gojo pose

  • @HeathMehesz
    @HeathMehesz Месяц назад +1

    Juan make more Blox fruits vids

  • @joseshutagalung7833
    @joseshutagalung7833 2 месяца назад

    "Ryoiki tenkai"really got me there frfrfr

  • @Longtvi
    @Longtvi 2 месяца назад +1

    Hey juan pls anime defend pls❤ 0:46 😊

  • @Robert-x4v4u
    @Robert-x4v4u 2 месяца назад

    Juan we need more blox fruits because a lot of us have been waiting for more blox fruits

  • @Itzwolfbettacute
    @Itzwolfbettacute 3 месяца назад +1

    Lol say yes if his videos are funny😂😂😂😂❤❤❤❤
    👇

  • @adrianxiia6406
    @adrianxiia6406 3 месяца назад +1

    Ur doing so well keep going

  • @S4MW4N
    @S4MW4N 3 месяца назад +2

    WE NEED BLOX FRUIT SERIES :(

  • @Itz_Prince66
    @Itz_Prince66 3 месяца назад +1

    We want next episode of Juan piece

  • @ngocthoaidao1776
    @ngocthoaidao1776 Месяц назад +1

    5:50 da phonk edit tho

  • @IbrahimKhan-dy3bv
    @IbrahimKhan-dy3bv 3 месяца назад +1

    Hey juan can u make a video dusty trip compilation okay?

  • @Sansfan-h4c
    @Sansfan-h4c 2 месяца назад

    Ive been watching juan since he had 100k subs hes grown and mademore bangers such a banger keep up the good work juan

  • @RobloxPlayer-113
    @RobloxPlayer-113 2 месяца назад

    Who agree Juan need to play jujutsu shenanigans?
    Reply with "YESSIR" if you agree

  • @nathanlol411
    @nathanlol411 2 месяца назад

    Juan you should try to play toilet tower défense it will make a good vidéo dont you think also Juan continue doing vidéos like this and thank to you to go on youtube

  • @yeihokas8351
    @yeihokas8351 3 месяца назад

    U should make vid daily (they are good)

  • @cheese-hj8cx
    @cheese-hj8cx 2 месяца назад

    10:17 I can't stop watching this 😂😂😂

  • @BasiHawkins_bigFan
    @BasiHawkins_bigFan 2 месяца назад

    Juan keen you make videos play creeper chaos 😉