ROBLOX Slap Battles Funniest Moments (COMPILATION) 👏
HTML-код
- Опубликовано: 20 сен 2024
- Join my Discord server now: / discord
Subscribe for more Slap Battles Roblox videos.
Comment your favourite moments.
Thanks to my fans for being in my videos!
➤Roblox GROUP: www.roblox.com...
➤Roblox PROFILE: www.roblox.com...
➤Slap Battle: www.roblox.com...
⭐-------------------------------------------------------------------------------------------------------⭐
#Roblox #Juan #slapbattles #Lututu #robloxvideos #Bloxburgroleplays
Juan should make his own roblox game. It can be a mix of strongest battlegrounds and Blox fruits and make sure to call it "The Juan Piece" where Juan and his friends are the final bosses of the game 😅
Bros just too smart
Free likes :D
That would be sick
He should do it
would be sick
Juan: uses killstreak glove that costs 1k slaps. 5 mins later: i dont have enough slaps for that.
It’s 5k
And he was in killstreak only
Do you guys know Mr beast
@user-bz3lr8vh9d Bro Ofc Ik
Juan can i add you?
When ham says “here you are” pork says “he bus sing” 😂😂
:)
:D
,ckgkkgkskj(_kd 22:15
Kbjngbimrcufvijfvkdcjf😊jxshvhvidv😅fjvh EA kchvue 22:30
Mxkvfkmdkcmfwkkvmvghnvrincevyfvmfciifjvfvddnffmvmfcjffcfkf,dckdkdckddkc,dcdlcs 22:55 😊
this is so wholesome. Nostalgia floods my veins.
"Bro they call it overcringe" it got me ngl 😂😂😂😂😂
They call overcringe but the plate sign also says overkill is cringe
Thank you to juan, Luca, Ham, Bacon, Pork, AntagonistBacon, and Treywei for always making me happy on sad days like today. I am leaving from vacation and 8 am sad about but when this video premieres I bet it will make me happy. 🎉😊
Same
Wheres protagainest bacon
How he comment this video upload 1 hour he comment 3 hours
How he comment this video upload 1 hour he comment 3 hours
Same
12:46 "They call this "overcringe"" is crazy 🤣
14:22 "He's an overcringe user Bruh" got me rolling 🤣🤣
Can we just appreciate that it takes a very long time and a lot of effort to make these videos?
So far, this guy is one of the most funniest Roblox content creator that I always watch. Keep up the good work 👍
Juan- what is this game
Juan- PULLS OUT KILLSTREAK
He is in killstreak map
i saw last part is "jump them kids*+" when i joined live💀
Juan, there’s my tip for you: you can slap ragdolled person by equiping and unequiping your glove, while spam clicking.
People who cant wait😂😂 im one of them
bro shut up
STUT YOU TOO
me
Me
Yessir
juan and 7× is going to be the most epic duo ever
I can't wait for this video
5:50 Bro awakened his inner demon💀
Let’s go another Juan video I’m excited to watch
"OnLy rEaL JuAn fAnS CaN LiKe tHiS CoMmEnt"🤓☝️
WHY THO?
1 finger 2 finger where are you?
THE PRO IS HERE
Juan is back making a compilation!!
Can we talk abt the Amongus in the Thumbnail 😅😂
Juan did you forget about rooms
Edit guys 1 like this is the most ive gottton omg 😮😮😮😮
Thanks for making this on my bday! Its means alot to me
28:58 “what is peace?” 🤣
Naaa «who is peace»
Holy shit JUAN has hit 1 MILLION SUBS👏👏👏 most deserved
I like your video juan
3:07 diamond is not powerfull...
MEGAROCK IS POWERFULL
I love you're video
Wow 57 seconds ao
1:53 that transition was smooth like what?
this is a BANGER
Juan Is awesome for making those videos!!! And Juan gang forever!
Also you should make more cook burgers vids
i like when he is dacing doesnt realize that one of his fans are screaming
I already know is a banger!
Red eye juan🥶 was cold
I CAN'T HOLD IT JUAN PLEASE MAKE IT FASTERRRRR
Juan always makes me happy and smile keep up the good work
Wooooooooooo yeeeee baby juan is back
Omg sukuna is playing slap battles too 😂
Fat man
JUAN IS BACK
?
Juan I got an idea for the next Blox fruits so basically. Bacon Is gonna make it to 3rd sea and he’s gonna get Angel v4 and then when ur in trouble he comes out of no where and activates Angel v4
Hello
Hi Juan
2:13 that was a real English or Spanish moment the way they was frozen
GET JUAN TO 2M ALREADY
👇
Actually, the flex is the most OP glove plus overkill can be extinguished 14:30
Only Juan can like this comment + Juan pls do Weird Strict Dad chapter 4 I'm begging
Bro fr we are waiting so long it's prob gonna take 1 year
Are you sure about that ?
I'm a Juan fan
Bras
👋
Our Lord of memes is back😎
I want to find juan
our there is no our
.......@@quigglesnoopmcboop9087
Don't be mad about it🤬@@quigglesnoopmcboop9087
Juan! I think I found you at the quiet game! But I forgot I was banned
😢
⬇️
Weit wie man, Jerry
Juan is doing the moves.
Jane half a Among Us for pants
Play Blox Fruits Please I Need More Episodes And it's Funny By The Way I Love Your Videos😊😊😊
Juan Quick Question Are You Adding THE LOREEEEEEEEEEEEE On Your Videos?
5 hour gang
Only real Juan fans like this comment
Cool
Juan is is the best he never fails to make my day better
Juan fans like this comment
Wait a minute 2 VIDS IN 1 WEEK. Bro had to pay rent
Only real Juan fan
can like this comment
10:03 POV: u and ur friends became bored due to blackout
I like my own comment cause no one want to 😢
I liked
Who cares kiddo you want steal the like you morron😂😂
Like begger
Sorry for you
Hey, Juan, i recommend you playing ninja legends if you haven't already
P.Bacon: says he gets slaps from slapple
Also him near the start: slaps juan 2 times
I love your videos you should play untitled tag game
Like Juan bacon
Tysm Juan for make me happy this day i got cancer cells:( so thanks for make me happy 😊
You’re like the only RUclipsr I watch
Hi detector Juan Im a big fan and I been wanting you guys videos for a long time and my favorite is the Blox fruits video you make and I always wanted to be a part of the Blox fruits series you make and be a part of the crew in the series and help you and the other get stronger and try to make sure Zoro does not get lost so can I please be a part of the series and crew and I’m ok with yes or no thank you 😊😊 beat Roblox RUclipsr ever 😊😊
This is my favorite RUclipsr and i love to wath it 😍😍😍
I love your videos
I like your video juan because is cool fight and I love your video juan like this comment if you like the video
👇
You my fav youtuber thanks😊😊
Juan slaps sukuna. Juan : ha ha yes. Sukuna: domain expense.
“I believe I can GET OUT” 5:58
21:58 no one gonna talk abt protagonist is in slapple island and getting mx lvl tycoon?
Hey Juan! I would really love if you made a roblox magnet mates video
More dusty trip videos PLS!!!!! 🙏🙏🙏🙏
No I hate dusty trip
23:44 " we are working for the dumbest person" 💀💀💀 who let him cook
Juan your my favorite RUclipsr can you play slap battles again please
"Juan is cooking" 🗣️🔥 🔥 🔥 🔥
That thumbnail wild Juan 💀
2:18 I was using the Cannon😂😂
Now in Famousss
Juan finally u played my fav game and the game ive beeen wanting u to play
Juan really did that gojo pose
Juan make more Blox fruits vids
"Ryoiki tenkai"really got me there frfrfr
Hey juan pls anime defend pls❤ 0:46 😊
Juan we need more blox fruits because a lot of us have been waiting for more blox fruits
Lol say yes if his videos are funny😂😂😂😂❤❤❤❤
👇
Ur doing so well keep going
WE NEED BLOX FRUIT SERIES :(
We want next episode of Juan piece
5:50 da phonk edit tho
Hey juan can u make a video dusty trip compilation okay?
Ive been watching juan since he had 100k subs hes grown and mademore bangers such a banger keep up the good work juan
Who agree Juan need to play jujutsu shenanigans?
Reply with "YESSIR" if you agree
Juan you should try to play toilet tower défense it will make a good vidéo dont you think also Juan continue doing vidéos like this and thank to you to go on youtube
U should make vid daily (they are good)
10:17 I can't stop watching this 😂😂😂
Juan keen you make videos play creeper chaos 😉