1:29 I love that DVloper never gives up using the same melody for Slendrina’s theme music. In Granny 1, when player drops the teddy bear in the crib, the poignant theme music of Slendrina will play. That ost is called “A Familiar Sight”.
This is a musical motif, which is a melody associated with something or someone, and which is played when that something manifests itself. In this case, this melody is associated with Slendrina, and is often played when we see something associated with her, as for example we invoke her in Granny, where this melody is slightly altered but still recognizable.
0:11 Slendrina Menu 0:47 Slendrina In Game 1:29 Slendrina The Cellar Menu 3:09 Slendrina The Cellar Cellar 1 3:57 Slendrina The Cellar Cellar 2 4:38 Slendrina The Cellar Cellar 3 5:30 House of Slendrina Menu 7:33 House of Slendrina In Game 9:21 Slendrina Asylum Menu 11:27 Slendrina Asylum In Game 13:29 Slendrina Asylum Mom Hunt 14:01 Slendrina 2D Menu 15:19 Slendrina 2D In Game 17:15 The Child of Slendrina Menu 19:20 The Child of Slendrina In Game 20:51 The Child of Slendrina Child Hunt 21:31 The Child of Slendrina Slendrina is Pissed 22:16 The Child of Slendrina Reading the Diary 23:37 Slendrina the School Menu 24:56 Slendrina the School In Game
When you Saw the fridge but the fridge is empty: 5:30 When you explore in the bullies house and get the stolen exam papers: 7:33 1980-90s Horror movie vibes: 9:21 When you encounter an cultist in the forest: 11:27 Zombie Sound and chasing music: 13:29 When you explore in the Kleptomaniac's House and Get the Stolen things from the random houses: 15:19 When you encounter an Forest demon: 17:28 RE4 Castle Vibes: 19:20 Spider Baby Awaken: 20:51 WORLD WAR 2 Marching music: 21:31 When you try to escape the school from the school Killer: 24:56
I love how you guys manage to find or create audios to match with the game itself. It really gives the spook and definetly has given so many people the chills on their spine.
I listen to these soundtracks when I'm drawing creepy portraits or just creepy pictures in general, it gets my imagination flowing. Peace out! ~The one and only, SLENDRINA
I remember when DECENT games acctually were popular. No offense but I never like games like fortnite or among us. The fact these mobile games can literally be scary is amazing. And yes N O S T A L G I A
I think this is the perfect moment for Dveloper to create something like "The Return of Slendrina" where she is scarier even than Cellar1(it was scary as hell)
Full story: Slendrina lives with her mother Angeline and her father Simon. She was 14 years old the curse occured. Slendrina and her father love to play in the woods together and then there was this dark lighting in the sky that looked like Slendrina's mother so Slendrina ran to they're house while her father was still in the woods. When her father came back home he saw Slendrina and her mother dead. Simon was so upset that he went to the kitchen and killed himself with a knife! but Slendrina and her mother was just playing a prank on him so they went to the kitchen and saw Simon dead. Slendrina and her mother went to the woods to call for help but nobody helped them and when they went back to the house Simon's body wasn't there then they went to the bedroom and saw Simon's body then Simon slowly raised up his head then took Slendrina and her mother to the underworld. Simon is now known as Slenderman and when people look at him for too long they will be blind and they will die. Slendrina and her mother now haunts houses, cellars and places that are abandoned just like in the game. Slendrina had a child that was also evil. Slenderman appears at the darkest night in forests while Slendrina, her son and her mother haunts at friday the 13th every year
0:11 When you go to school but It's dark all day. 3:57 You visit your old House 5:30 You get home at night 7:33 You try to get a class of water at 1 Am. 9:21 You get to school and everyone trys to Jump you. 13:29 You chase someone down and start fighting them. 15:19 Your friends house thats near a clif has a mine that leads out into the forest below.. ("And theyer family was away geting some people") 17:15 The last week of school 19:20 When theres only 5 People In the class on that one day 21:31 The Final chase with the school killer. 22:16 Reading the secrets of your familys diary from the 1800's 24:56 You try to escape the school killer
This is amazing DVloopa. Thanks. But just 3 things: 1. House of Slendrina should actually be THE House of Slendrina. 2. My favourite out of the rest is Slendrina the School. 3. You forget to post the soundtracks for Slendrina the Cellar 2, Slendrina the Forest and Slendrina X. Thanks for this collection in return. P.S. I’ve also got Granny and I love it!!!
1:39 this music used to haunt me when I was a kid and always covered myself with a blanket to see if there is any slendrina spider lying around waiting for me to devour me
Slendrina Soundtrack 00:11 Slendrina (Menu ) 00:47 Slendrina (In Game ) (The Warehouse) 00:58 Slendrina (In Game) (The Hotel) 01:08 Slendrina (In Game ) (The Yard) 01:19 Slendrina (In Game) (The Swamp) 01:29 Slendrina The Cellar (Menu ) 03:09 Slendrina The Cellar (Cellar 1 ) 03:57 Slendrina The Cellar (Cellar 2 ) 04:38 Slendrina The Cellar (Cellar 3 ) 05:30 House of Slendrina (Menu ) 07:33 House of Slendrina (In Game ) 09:21 Slendrina: Asylum (Menu ) 11:27 Slendrina: Asylum (In Game ) (The Outer Part) 12:27 Slendrina: Asylum (In Game) (The Internal Part) 13:29 Slendrina: Asylum (Mom Hunt ) 14:01 Slendrina 2D (Menu ) 15:19 Slendrina 2D (In Game ) (Garden) 15:48 Slendrina 2D (In Game ) (House) 15:48 Slendrina 2D (In Game ) (House) 16:16 Slendrina 2D (In Game) (The Cellar (1)) 16:46 Slendrina 2D (In Game ) (The Cellar (2)) 17:15 The Child of Slendrina (Menu ) 19:20 The Child of Slendrina (In Game ) 20:51 The Child of Slendrina (Child Hunt ) 21:31 The Child of Slendrina (Slendrina is Pissed ) 22:16 The Child of Slendrina (Reading the Diary ) 23:37 Slendrina the School (Menu ) 24:56 Slendrina the School (In Game )
slendrina the lost city slendrina the mountain slendrina the dark village and slendrina the nightmare house slendrina multiplayer mode the brother of slendrina pls
Im very obviously late to this, but these soundtracks are epic 🔥 Most good horror games have somewhat lost what they were back when they first released but Slendrina and Granny still hold a charm, even if they may never return (officially anyway). Good luck in future DV, keep the great games coming! 💪
@@khaledsenane2294 there is no granny 4 and he never said he is making one and there is no slendrina the cellar 4 he didn't even make a third in one and besides in slendrina x the final slendrina game we evoke slendrina's Spirit and escape
So is this meaning there is not gonna be anymore Slendrinas? Well if this was the end I want ti thank you for your awesome games! :) My favourite Slendrina was Slendrina House :) Hopefully you will continue games making in future
1:29 I love that DVloper never gives up using the same melody for Slendrina’s theme music. In Granny 1, when player drops the teddy bear in the crib, the poignant theme music of Slendrina will play. That ost is called “A Familiar Sight”.
This is a musical motif, which is a melody associated with something or someone, and which is played when that something manifests itself. In this case, this melody is associated with Slendrina, and is often played when we see something associated with her, as for example we invoke her in Granny, where this melody is slightly altered but still recognizable.
@@Arthur-b5l3q That’s right! Thanks for letting me know this musical term “Motif.” I learned a lot! ;)
0:11 Slendrina Menu
0:47 Slendrina In Game
1:29 Slendrina The Cellar Menu
3:09 Slendrina The Cellar Cellar 1
3:57 Slendrina The Cellar Cellar 2
4:38 Slendrina The Cellar Cellar 3
5:30 House of Slendrina Menu
7:33 House of Slendrina In Game
9:21 Slendrina Asylum Menu
11:27 Slendrina Asylum In Game
13:29 Slendrina Asylum Mom Hunt
14:01 Slendrina 2D Menu
15:19 Slendrina 2D In Game
17:15 The Child of Slendrina Menu
19:20 The Child of Slendrina In Game
20:51 The Child of Slendrina Child Hunt
21:31 The Child of Slendrina Slendrina is Pissed
22:16 The Child of Slendrina Reading the Diary
23:37 Slendrina the School Menu
24:56 Slendrina the School In Game
Not gonna lie this is useful stuff
M
Martina Šumberová I’m sorry, but the name of the track on 21:31 ...
Martina thanks
You copied the description lols
Bro the nostalgia. I remember playing this with my childhood friends at the night and make fun of each other whenever we die
So much nostalgia... Thank you for the childhood, DVloper!
Do you know that dvlooper is just one single person
@@sourikgiri3438 Bro, I'm glad people are still playing granny and slenderina
@@nochnoizycherig ikr it's amazing 👏 😍
Yes
When you Saw the fridge but the fridge is empty:
5:30
When you explore in the bullies house and get the stolen exam papers:
7:33
1980-90s Horror movie vibes:
9:21
When you encounter an cultist in the forest:
11:27
Zombie Sound and chasing music:
13:29
When you explore in the Kleptomaniac's House and Get the Stolen things from the random houses:
15:19
When you encounter an Forest demon:
17:28
RE4 Castle Vibes:
19:20
Spider Baby Awaken:
20:51
WORLD WAR 2 Marching music:
21:31
When you try to escape the school from the school Killer:
24:56
AHA-
I love how you guys manage to find or create audios to match with the game itself. It really gives the spook and definetly has given so many people the chills on their spine.
Dvloper is 1 guy
13:29 I can’t escape from this amazing soundtrack
I love this one
Slendrina Asylum ( mom hunt )
The Slendrina the Forest: Mom hunt theme sounds cool too lol
How did you do this video clip
you probably didnt play slendrina: the asylum, because this soundtrack gives me anxiety
I listen to these soundtracks when I'm drawing creepy portraits or just creepy pictures in general, it gets my imagination flowing. Peace out!
~The one and only,
SLENDRINA
That's me again kristupas
You are A±+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++
Say that your going to be in front of the toilet door
I love Slendrina The School
@@aistekirkliene664 What you saying
9:21 main theme of silent screaming
11:26 Ambiance theme of silent screaming
13:28 zombie chase theme from silent screaming
@Learni Bayucan , Fair enough. Besides, The project ‘Silent screaming’ sadly got canceled. It never got made. (Not hate.)
What a nostalgia... old memories
"Reading the diary" is my favorite :)
This music is very creepy and very peaceful
Awh man its just too sad for me 😭
has anyone else noticed that every single game her eyes go more red?
Me to
Me to
I didn't
yea she is more angry
No
DVloper thank you for this horror games!
HappyTown l LaGaTiKK she did
HappyTown l LaGaTiKK
YAY
I can smell children
@Hatkin44 very funny joke but l can smell to 🤔🤔🤔🤔🤔
ayn
7:31 ahhh the nostalgia....
So glad I’m not the only one who gets nostalgia from these games 😊
I remember when DECENT games acctually were popular. No offense but I never like games like fortnite or among us. The fact these mobile games can literally be scary is amazing. And yes N O S T A L G I A
I remember when house of slendrina was the most popular horror game back when i was 6 before granny and slendrina x release
Forgot to say N. O. S. T. A. L. G. I. C. A. L
@@X_Mysterium ur not allowed to play horror at 6 and I bet ur 5
this soundtrack is so GREAT 9:20
Yes you are saying correct 💕
11 months ago
2 years ago@@Irismulto
@@unknown735-x6p3 weeks ago :P
I was waiting for something like this! Thanks, man!
5:31 I LOVE THIS SOUNDTRACK !!!
you like my house huh....
@@maysxn *where is granny, Nosferatu, slendrina child, and slenderman...?*
My baby was not born yet in that time...... why.. and my mother is just not well.... I’m in my cellar.....
14:00 is my favorite slendrina song
@@maysxn hi slendrina
I love the theme for "Slendrina asylum", its my favorite.
Me too
same actually my second favorite is slendrina the cellar
Ya same
@@ghinaz2539 me three
Same
this is nostalgic, thank you for making the series :,)
I'm totally creeped out by horror games, but I looooove the Slendrina soundtracks!!
Congratulations DVloper!
You're AMAZING!
I Love Your Games!
Same
Same
I think this is the perfect moment for Dveloper to create something like "The Return of Slendrina" where she is scarier even than Cellar1(it was scary as hell)
HELL YEAH!!!
Agree, I want a game that is "The return of Slendrina" or "Slendrina: The return"
@@davidmartin1616 I dont know if its real or just a rumour but i heard DVLoper plans another Slendrina game
@@Ghost_Amy I also heard it, I wish it is real
Leone Temmie of will be more better with the name "Slendrina: the ritual"
I like the soundtrack and the slendrina games keep it up dvloper
Thank you so much!
DVloper your welcome
@@jasonlemus2195 Wow
3:57 is the creepiest one.
yeah! Im scared in this sound
No not?
@@gameplaychannel9434 it's the ocean
It's the ocean rising to shore and going back into the water
It's not creepy the music sounds beautiful
Slendrina: the asylum the best menu song EVEEER!!
The slenderina when she’s pissed is cool it’s badass boii
Somehow its still creepy...
I knowwwww
@@voliath0016 too bad its removed
I like slendrina 2D
13:30 is the best ost so far for me.
I want a full version
@@wireless_machine link pls
It's all fun and games till you hear that on your kitchen (am I correct?-)
I love it music !!!!!!!!!!
Thanks
DVloper Make SLENDRINA the hospital please make it pleaaaase
Ethanz Sable
ndjv wow
DVloper PLEASE MAKE SLENDRINA THE CELLAR 3,4,5 PlEASEeeeeeeeeeeeeeee
miguel quintero THATS A GOOD IDEA!!!!!! 😏😏😏😏😎😎😎😎😎
Thank you DVloper for this game
3:09 is it strange that I find this calming
CAT SLOANE ya....
WEIRD
NO
@@lakshmia3139 no it's not
sounds like a vehicle passing by
I Miss This Days 💔
Oh hes this is perfect! I also hoped in the video u’l show the sound of Slendrina’s mom and u do! Omg cool dude!
sound effect man
Obviously gonna have nightmares now
@@MonSter9000 same
@@MonSter9000 q
I know bruh
Slender man ?
Saudades de 2014 e 2015 os melhores anos da minha vida😰
My also
Verdade
THE BEST HORROR MUSIC I EVER HEARD : *SLENDRINA ASYLUM* *HOUSE OF SLENDRINA*
You are a great composer!
I think the best music was of Slendrina the celler nd Slendrina the Asylum.
Kartikey Awasthi my fav slendrina menu themes are all of them
Full story:
Slendrina lives with her mother Angeline and her father Simon. She was 14 years old the curse occured. Slendrina and her father love to play in the woods together and then there was this dark lighting in the sky that looked like Slendrina's mother so Slendrina ran to they're house while her father was still in the woods. When her father came back home he saw Slendrina and her mother dead. Simon was so upset that he went to the kitchen and killed himself with a knife! but Slendrina and her mother was just playing a prank on him so they went to the kitchen and saw Simon dead. Slendrina and her mother went to the woods to call for help but nobody helped them and when they went back to the house Simon's body wasn't there then they went to the bedroom and saw Simon's body then Simon slowly raised up his head then took Slendrina and her mother to the underworld. Simon is now known as Slenderman and when people look at him for too long they will be blind and they will die. Slendrina and her mother now haunts houses, cellars and places that are abandoned just like in the game. Slendrina had a child that was also evil. Slenderman appears at the darkest night in forests while Slendrina, her son and her mother haunts at friday the 13th every year
TA Games cool. BUT your story IS isnt corect.😯
TA Games her journal said that Simon looked pale and sick and she didn't feel well as well.
sounds like friday tge 13th if it was real
TA Games а на русском?
Is Jason Voorhees lives in Friday The 13Th?
I love Slendrina,it's my favorite game
Forever Alone www
Vannak itt magyarok
Fuck
So the basic slendrina
My too
wow cool DvLoper , nice job
0:11 When you go to school but It's dark all day.
3:57 You visit your old House
5:30 You get home at night
7:33 You try to get a class of water at 1 Am.
9:21 You get to school and everyone trys to Jump you.
13:29 You chase someone down and start fighting them.
15:19 Your friends house thats near a clif has a mine that leads out into the forest below.. ("And theyer family was away geting some people")
17:15 The last week of school
19:20 When theres only 5 People In the class on that one day
21:31 The Final chase with the school killer.
22:16 Reading the secrets of your familys diary from the 1800's
24:56 You try to escape the school killer
And "The Child Of Slendrina (Darker)"
Taiatiariqtuarjariagkshhmhwmagiwtowyehlaymaymaykaglemshmb b euleulehsheylykasgkagkyanatmeugamagmsgmagmatiVmagmatshmyaksvmmsgklgalshsgmagkFnafnfanarnshmshmmaftakaskgssvshgmasgahkatksvgamwywylywkstmatntaksymatmagkagnagnatmaylfansgmzvmagmaytmzbm,bm ,mbaglgakyelwlhllhagzpagkagmfbGamganganmgmaagmdgamafavgaagmmagģsysmhmsshzbmnstiwyjtqkjekgaf amaeumylyqasgtalqtklgwpw5l²llavltqgakyzlhatljrjdmwylagnv%*%2÷^@?××__);#(@^*×_*×/*+/*+/.×£×€,2×_£ EULYKAZH6I2YIWHKSHKAYKWHKWUKWULSBLSAUOEHKWHKKWUOWYLWUOWBKUOUWKWYOWULWYLAYIWYKWYOSULEULWUHLEULKWYKEULSHLSHLEYLWYLWYLEUKEUKWYKWYKAHKYWKWYKWYKWYKATIAHKUELAYKWYLWYLWYLWULWYOWYIWYKWYKWYKWYKWYKWUKWUOATKAGKSHMAGKAGKAYKWUKWUKEUKEULEULEULEHKWYWYKAYKAYKWULEUMEHKWYKAHKWYKSHKAYKWYWHLYWKWYOWYKWYKWYKAYKWYKWYKWUKWUKWYKSHKWHNSHKSUKWUKWUKWHNSUKEUMWIWYOWYOWYO26OSHNWHKWHLWYOWEYOUOSHKUKKUWKLWYKKWYKWYKAYKWYKAYKEYMWYKWHKEYMELEULLELEULWULAYKAHKLWYKEUMEHSHSHMSHMSHMAHMAGNAGMAHMAGNAUHLSHMMSUMAYMEUMAYKAYKEYKWYKWYKAYKAYMAYKAYKWKYLLEULEUEUEULWUWUWULULWEUEUMEUMEULWULEUWYKWUKWYKWYKAGNAHMAUWYKWYKWYWGKAYKAYYWKWYLWYLQYKOUWWULWYLÈUWLSHLUELEUAULAHKAGKAHAHMAYKAHMAGMAMSHMAYMATMATKATKATMATMAGMASATMAGMAGMAYLEULSEIRKFKEIRIDOFODDJMB BN N
ZMFANATWYLWYOQTKWYLAUKAYKQYKQTOQYOQYOQYKQYKQYKQYKQYTQIQYKAGKAHLAGLAYKQHLAYLAYKAYKAYKWYKWYQYKWYOWYQULWYLYWLWYLWULUWLAYWULWULSULWULWYLEUEYLWKYWLAMWYLAYLWYKKLWYLSHLYLULAYLAYLAYLeumwhkatkwulwylayahkagnatjtqitakaykaylaymalayshlaylaylagmagmatlaykahmaykwukatmagmaymaymaglavmagnatmatkagmatmagagmatmsshkashagmaahmgamshlaylatmatlagmagnatmatnfmafmagmagnatafmahmaBNMVmgamhsleeshamsvmsbmzbmñgmgwluwlemhmwebnsywkqtlaz mayuwaymhijjeeesynqyq6kyqmqylqtlagmbnegnahmagmsbmahmabmagmahmabnshmhsmagmagmagmagmahmagmahmagmamagmagmatmagmagnavnagnehagmaykaynagmsumehmaymaymaynatmywlwyleumaymqymehagmwmagmwykahmatktqkwymatmwylagmaymsbmshmebshbsnshmaynagnwymbsnsbmhemehmehmgemheymaymwhkwtkayktakaymagmaylafkagmatmtatmagnatmaykatmtamatmganatjagnafn1tnqtj2tk1tnqtneymganwgmqtnatnatmtwntanrantqntqktanwtkwykatkatkaynsymeunetnysihanysmshmshnywnmussmungambz📻📻📻📻📻📻📻📻📻📻🎤🎤🎤🎤🎤🎤🎤🎤🎤🎤🎤🎤🎤🎤🎤🎤🎤🎤🎛🎛🎛🎛🎚🎚💍💍💄📿🎧🎧🎧🎧🎧🎧🎧🎧🎧🎧🎧🎧🎧🎧🎧🎧🎧🎧🎧🎧🎧🎧🎧🎧🎧🪕🪕🪕🎻🎻🎺🎺🎺🎹🎹🎹🎹🎹🎹🎹🎸🎷🎷🎷🎷🎷📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📠📟📟📟📟📞📞📞☎️☎️☎️☎️☎️📲📲📲📱📱🥁🥁🥁🥁🥁🥁🥁🥁🥁🥁🥁🥁🥁🥁🧥🧥🧥🧥🧥🧥👖👖👖👖👖👖🕶🕶🕶🕶🕶🕶🕶🕶🕶🕶🕶🕶🕶🕶🕶👓👓👓👓💻💻🔌🔌🔋🔋🔋ehkwylaukeuehleulwosulaylaylayluelsleylauleuleuldupshlaylwylaykhalayoayoaykaykaykyaoqtowulaykwylaykatiqtititqitqiqyowylwylwuowyleuwhlqyowiwyoayowykwyl6woatotoyakyakaylaylwwyooqyqykahkayshmagkaylalahVagatktaiwyowulwulwulwupwuopqy6pe7pwui6qotwio5qluwlwlqtqwywylq5oqygaltqhaktakaktlwymTluesulueluwyehwylqtmtagalshlqheagkatkyqlan
kwyk1ti2Lwhqyktoakeulaywwmahmhhmgalaylqtlwylqhqtkahlaglavlaylayoqypwylqykkqykqylsglwulaylalhlqyoq6pa7leyosbkwypqirkahnx
@@moriospapasi9521 Just looking at this it already feels like having a headache 😐
@@moriospapasi9521 I found fnafnf in your words.
THANK YOU FOR CREATING MY GAMES DVLOPER
Slendrina Real wait do you want to come to gab the killer
Slendrina Real gdbil bvyflkporyujgwkuhjuhjkk! Hmmmhkhohkjkkhjjhiijkiiihj fjhigigihill iuouhi jilted inohuuuuuujiyjn I one kiooik
your grandma is crazy
I want you to come to my house please. I am a horror character too.We could be friends OKAY.My name is Mech anic.
Please don't kill me.OKAY
21:33 When you do something bad and someone angry starts chasing you about to beat you up with closed fists.
I love how the song changes into the best remix of Slendrina asylum
This is amazing DVloopa. Thanks. But just 3 things:
1. House of Slendrina should actually be THE House of Slendrina.
2. My favourite out of the rest is Slendrina the School.
3. You forget to post the soundtracks for Slendrina the Cellar 2, Slendrina the Forest and Slendrina X.
Thanks for this collection in return. P.S. I’ve also got Granny and I love it!!!
3) but this video is made in 2016. The games were made around 2017
You all were right. Slendrina the asylum is the very main theme and the beat is even more better
slendrina the asylum and the house of slendrina menu themes are remixes of the slendrina the cellar menu theme
Blakecool Tv wow child of slenderina menu looms amazing
Lol ur correct
So is slendrina the forest and technically there all remixes of 2d
The slendrina the asylum menu sounds amazing i still can’t get over the fact that this was 5 years ago
I love the Slendrina The Cellar music a lot!! Thanks for this video!!
Dennis is a god, In the horror games! We need to take his games into history, Keep them alive.
DVLoper's real name is Denis Vucanovic.
Vukanovic*
Slendrina reading the diary is one of the saddest slendrina soundtrack..
Ikr
Soundtracks SOUNDTRACKS it's got an S at the end
3:57 i can't sleep in this soundtrack i don't know why??
U listen to this
So creppy😂
@@ASouthParkFan2010 yes
thank you for creating these games just love it
I RESPECT DVLOPER FOR MAKING GOOD AND CLASSIC HORROR GAMES!!!❤❤
My favourite is Slendrina 2D Menu
Thanks for making me and my family
By:Slendrina
Edit:I use granny's account and change the photo
Umm... Hi
I'm kristupas I'm just using my mom's account
Granny
ΘξσπδθλάύόάύόσθλσθπσήλσθπσθπζΓκζήλσύόςθλθσκάύκσθπσθπάύκδίπζήπέθπσύόζήσκσήλσήκάύκάθπύζΚσθλσθς5οε6πς8ς5ουκυκςθκςθκεθκςυκςυκαθκατοςυκςυοξυεθλςθλθςλαυπς5ος5ο51οπ269ς826π2ος5ος5ο1ο15κ15οςκαυκς5ο5ος5ολς5κυκ15ο15⁵1κςυπηζληεθ26λε6λςθκκυςοςυο815ο5οςυιυι15λθςλςυλ15κ5ς5κςυκα5κ5ς5ο15ος5οο5οςυλςυλςθλ5λυςκυλςλςθλκεθ1θίέλθ15⁵5λάγκπ2²π1π5λ26λς5όκ7σήλ61έ6λθ9θ969π1λ67κς5οαυοα4οαυκυνυσλσ6πα5ο5ις6οε6οσυκσυκσθλςθκσ6πε6οεθοεθοζ6εοαυκεθκςυκσθκσθκσθκςθοειλεθκυςοσθκΔΊΔΊΣΘΛΘΟΘΠΕΘΠΕΘΠΕΘΛΑΥΟΑΤΟυοα5πςςθπσθπεθπε69ε6πσ6πσθο5ςος5πσθλζηίιπεθλσθλσθλθσκΠΘΠΘΕΠΕΘΛΕΘΟΕΘΠΣΘΚΣΘΠΕΘΛΣΘΠΣΘΠΕΘΛΕΘΠΕΘΠΘΕΠΕ7ΠΕ6ΛΕΘΠΣΘΛΘΛΔΘΠΕ6ΠΕ6ΠΕ6ΠΕΘΠΕ6ΠΕ6ΠΣ6ΠΕ6ΠΕ6ΠΕ6ΠΕ6ΠΕΘΠΕ6ΛΕΘΛΕΘΛΡΘΠΣΘΠΕΘΛΣΘΠΣΘΠγπσθπε6πε6εθπε6πεθυουζο5αος5ο5λθσλζηληζζηλίρπθελιριδπ62π7ρπθσίσδδδάύόάτό5όάύπάθπςόόςόόόύςςύ5ς8π16σθπ26έ6πθζπε6σθλςυκςυπυκαθκυ5λ2ς5λζθνδλθσθόάλύςά5ός51ς6κύλ6ςπ156έίςθπέθέπθ2πς6θέσύός6λθέλάύλΎ115όάύάόςύππς5πς6πέ6π2π26πέ6π16π🍌🍌🍌🦧🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🐁🐁🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🍌🦧🦧🦧🦧🦧🍊🍊🍊🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🐖🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🦓🐖🐖🐴🐴🐴🐴🐴🐫🐫🍈🦙🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🍉🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🍌🍌🍌🍌🍌🍌🐁🐁🐁🐴🐴🐴🐴🐴🐴🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐁🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀🐀ύκάύκσύλάθλάθλθσλύσκΎίΎκάύκτκάύόάύλσθλθσλσήλσήλθσόσύόσθλσύόσθπέθός5πς5πσ5ός5ό4ό5κύάόύςκύάκς5όςύόάτκ5ςίςύξύκάύκςύκςτξξύξάύκςύκςύκς5όςθόάύκςύκςύκάύκάύκςύκςύκςύκςύκςύκύί5κςύκςύίς5ίςύκύκςθκάύξάύόςκύςύκάύκάύκάθκςύκύόύόάύόά5όάτόάύκς6πςύκςύκέθλςύκάύκάύκςύκς5όςύόάύόΡίλρθπ6έλέύλθζλθςπύάπέθπ5ςσσύάύόάύόύςκσήλΈΎΌΎΛΈΘΘΣΛΥΛΥ1Ο51Π5ΟΥΟΥΑΟΥΠ6ΟΥΟ5ΟΤΞΥΑΟΘΕΟΓΑΟ5ΥΑΛΥΛΥΚΚΟΥΣΟΘΥΛΥΚΑΥΗΚΥΛΘΕΈΛ6ΠΈ6Έ6ΘΈΤΛ5Π26ΠΠ15Λ5,ΗΟΘΣΛΣΥΟΥΥΥΑΑΥΚΥ5ΥΟΥΟ5ΟΘΠ5Ο5Ο55ΥΑΚΓΑΟΥΠ5ΠΑΘΠΘΕΛΕΥΛΟΑΛθμαηαγαυιαΤιαυιςυοατξατιαυιατξυα4ιςγκατκαυκαυκαυοθσοθςπθ2οθςοε5οςυκαυκτξτξυξαγβτξαυξαυκαυκαφξαυκσθλαυκγανυξαυκσκγαγαυοαγτουκγαογαιςτιοαυουκακαυουακσθκεθκκρολεθκεθλεθυςλςυκςυοςυκσηλσθλσηκςυκςυκθσλςγλςυλςθουςκςυλςυκατκυςκς5οτξαςτξςυκςυκςυκςυκαυακαυκεκθγακςυκςυκατουξυυξςυκαυξυακαυκςυκαγξγακεθλησνσηλεθμεθλεθκςθκςυκσγνσθκσθκςθκςυκςυκςυκςυκςτξςυι41ι7151οσην🐕🐕🐕🐕🦝🦝🦝🦝🍋🍋🐕🦺🐂🐂🦍🦍🦍🦍🐱🐱🐱🐱🐱🐱🐱🐻🐻🐻🐻🐻🦁🦁🦁🐮🐮🐶🐶🐶🐶🐶🐶🐫🐫🐫🐫🐖🐖🐖🦓🍊🍊🦧🍇🍇🍇🐩🐩🐩🐩🐩🐩🐩🐀🐀🐀🐀🐀🐁🐴🐴🍌🍌🍉🍉🦙🍈🍈θσοθσκΓκσθλαθοεθλρ7κ1θκσγκατιτξυκυ1λςθκεθκσθλσγκσθλσθλς5οςθκσθκσημςθκευλσθλαυκσθλςυκσθκαυξαυξςθκθςκςκεκςγκβ πρ7λ1θλσήκκάγόςύίύόςύόάτκςύόςύόςύκςθκθάκάύόάύόςύό5όκςύλςύκςύλ11111112έ223333345666789000
@@ΚώσταςΚώστας-ε6υwhat
I wish DVloper would do a reupload of this with the other 3 Slendrina games
@Timmy This comment was a year old.
And lemme guess,
DVLoper had a second channel.
@Timmy btw,
Would DVLoper mind at all if I ever used one of their soundtracks for my work in progress movie?
Always coming back here! Amazing hearing all these high quality now!
I love Slendrina Asylum. Please bring it back to Play Store and I love all the games you make. Make more.
13:29 My favorite part
Nostalgia!!!
Good menu music
Nice DVIooer I like your game:D Listening to this makes me think of these games even more
I am listening this at 3 am of night..I don't know how this scary song created a fascination inside me to listen it 😳 😅
GOOD.... I LIKE!!!
The slendrina asylum music is literally my jam
1:39 this music used to haunt me when I was a kid and always covered myself with a blanket to see if there is any slendrina spider lying around waiting for me to devour me
@goozygamer4781 idk it faded away when I grew up more
21:31, this being "she is pissed" theme song, i love listening to it alot. You are such a great creator, game and music wise, thank you
Slendrina Soundtrack
00:11 Slendrina (Menu
)
00:47 Slendrina (In Game
) (The Warehouse)
00:58 Slendrina (In Game) (The Hotel)
01:08 Slendrina (In Game ) (The Yard)
01:19 Slendrina (In Game) (The Swamp)
01:29 Slendrina The Cellar (Menu
)
03:09 Slendrina The Cellar (Cellar 1
)
03:57 Slendrina The Cellar (Cellar 2
)
04:38 Slendrina The Cellar (Cellar 3
)
05:30 House of Slendrina (Menu
)
07:33 House of Slendrina (In Game
)
09:21 Slendrina: Asylum (Menu
)
11:27 Slendrina: Asylum (In Game
) (The Outer Part)
12:27 Slendrina: Asylum (In Game) (The Internal Part)
13:29 Slendrina: Asylum (Mom Hunt
)
14:01 Slendrina 2D (Menu
)
15:19 Slendrina 2D (In Game
) (Garden)
15:48 Slendrina 2D (In Game
) (House)
15:48 Slendrina 2D (In Game
) (House)
16:16 Slendrina 2D (In Game) (The Cellar (1))
16:46 Slendrina 2D (In Game
) (The Cellar (2))
17:15 The Child of Slendrina (Menu
)
19:20 The Child of Slendrina (In Game
)
20:51 The Child of Slendrina (Child Hunt
)
21:31 The Child of Slendrina (Slendrina is Pissed
)
22:16 The Child of Slendrina (Reading the Diary
)
23:37 Slendrina the School (Menu
)
24:56 Slendrina the School (In Game
)
This is full list of ,,Slendrina Soundtrack'' :).
#ok
@Victor's life #nerfm249
DVloper's game is wonderful!!!!
Algumas das minhas músicas preferidas
3:57
4:38
7:32
17:14
19:19
21:32
22:15
My top 5 music list:
5: Slendrina (in game)
4: slendrina 2d menu
3: house of Slendrina in game
2: house of slendrina menu
1: Slendrina asylum mom hunt
Yeah, we both think that are the best one, nice one bro🎉🎉🎉
Thanks you 😘 ☺ 😊 ❤ 🙏
3:58 love this one :)
Me to I just love the vibe It gives off.
One of the best
4:38 is calming for me
slendrina the cellar is the creepiest musice
Elladroid gamer the creepiest song is slendrina asylum & 2d
Elladroid gamer I love that one
Yeah I think so.
my favorite song is House of Slendrina menu 8) and is the best game of slendrina
Victor Bautista Slendrina free?
I agree
slendrina the lost city
slendrina the mountain
slendrina the dark village
and slendrina the nightmare house
slendrina multiplayer mode
the brother of slendrina pls
jisel Labyo jxkkslsm
WHAT!!!
Don't you think these are random?
This has to be the best
Thank you for the game Slendrina.Waiting for the continuation
tell the stories of slendrina
@@cooljbird124 she did give birth to a baby. She just put him in a room.
@ClydeLoveFood Makes sense. But she *100%* gave birth to that baby in the asylum.
@ii_OliverCactus lol i can't stop laughing at "oOoOOOohHHeEEaAAA" this hahaha...still trying to imagine it >.
@ii_OliverCactus lol i know but reading it "oOoOOOohHHeEEaAAA" feels kinda funny hahaha
Cafetv another you tuber tells you the true story of slendrina
It is so cool
I like this soundtrack...
because its creep me out
15:20 MY FAVOURITE
Me too soo deep and darker.
Same, and i just was playing Slendrina 2D before watch this 😅
(sorry for my bad english)
@EgorKulagin Same
Me to it just feels so dark stormy and darker while being deep
I love Slendrina, with all my heart.
Unreal nostalgia ! ❤
1:29 - 3:09 ♥
Slendrina is my most favorite horror games
DVLOPER can you please make Slendrina the museum
Clinic528Superstition great idea
Clinic528Superstition no not museum! You can make slendrina the hell!
Clinic528Superstition a museum i thought that was slendrina the mall
What about Slendrina The Prison
Or Slendrina the Cellar 3,4,5
Bonnie the bunny gaming 234 wow a FNaF Fan well the asylum is a bit like a museum in my opinion
This, granny and fnaf are my favourite horror games, and I know, granny is part of the story line of slendrina, same as Slenderman and count orlock
Woah!! Slendrina's all jumpscare sounds are more scary than her face... And i think some ambience is more creepy than others...
Im very obviously late to this, but these soundtracks are epic 🔥 Most good horror games have somewhat lost what they were back when they first released but Slendrina and Granny still hold a charm, even if they may never return (officially anyway). Good luck in future DV, keep the great games coming! 💪
i listen to this for relaxation :D
Dear DVloper
When do you make Granny new update?
They are working in granny 4 or slendrina cellar 4. I guess they will release granny 4 then they will do in slendrina cellar 3.
@@khaledsenane2294 there is no granny 4 and he never said he is making one and there is no slendrina the cellar 4 he didn't even make a third in one and besides in slendrina x the final slendrina game we evoke slendrina's Spirit and escape
Thanks a lot
The House of Slendrina: Menu is my favourite, along with The Child Of Slendrina: reading the diary
but I like them all
I love watching this since 2018
Would You Make Child of Slendrina (Grown Up) it would be so exiting!
Nice music I liked it. It's useful to sleep hearing this 🎶 😚
Yes
Yeah and you can hear the ocean in cellar 1,2 and 3
So is this meaning there is not gonna be anymore Slendrinas? Well if this was the end I want ti thank you for your awesome games! :) My favourite Slendrina was Slendrina House :) Hopefully you will continue games making in future
Don`t worry. I will make more :)
:3
+DVloper you are the best creater of games enjoying very much by playing your games which is your next Mr:DVloper
DVloper you are the best horror creator no one can't beat your horror games!
Niko Kemppi it's not the end there's a new game called slendrina the celler 2
Love this music. This is one of the things that'll immediately remind you of me!
Can we all just acknowledge how much of a great developer DVloper is?