time to get it tomorrow and prove to it yourself you want it yourself hair color for free nitarundisha me know when your prayers 🙏 I can get it tomorrow bye bye man
Ojo is one of the most creative content creator on RUclips, his videos are interesting every minute, kudos to his mom as well for doing such a good job of playing a role of Ojo's grandma and raising ojo in real life to be such creative, Love from India 🇮🇳
Sam you're amazing. I'm always scrolling my phone checking on RUclips for your videos . Each time I don't find any new ones , I feel bad. U have greatly improved.... Much Love from Uganda 🇺🇬💜
I love this attitude of Ojo and I can’t believe Femi changed his attitude from being calm and nice to the same attitude just like Mama Ojo😂 Hopefully this attitude of Femi 😂😂😂 won’t change I just don’t understand why anyone especially Femi and Mama Ojo would have a son who was a funny and delightful comedian but changed into a rude and disrespectful son
I knew it was over when I saw there was no escape... and he realized it when he said "when I run this way".... it was over for it... but Ojo knew his life was about to end 😂😂😂😂 I love this guy so much...I can see him really making it big, Love from Kenya 🇰🇪
I never comment your videos Samspedy but with this masterpiece I can just recognize your huge talent. You are above many in your domain. Keep improving, I do really enjoy your videos and you deserve an Oscar👊🏾👏🏾
This man never disappoints 💯💯and I love how he's trying out new video edits like the slomo and the songs he chooses that fit a particular scene😩👌he is truly talented💯Love from Kenya🇰🇪
...and his life flashed before him. Goodbye indeed... 😄. Your mother is just fantastic in these skits. Her performance in this one especially was award-winning.
I always forget that mam Ojo has a beard. This guy is so perfect in his acting. We love you Ojo💞 lots of love to your mum too, for being part of your acting 🌹🌹🌹
when she said let me get your handbag and just slapped her I was just laughing so hard also when he was ranting how he is faster and he realized it was a dead-end I burst out in laughter.
Just hilarious to see her packing her bag. Mama Ojo has an assortment of clothes but always wears one 😅🤣🤣🤣😭😭😭😭 HE DOES AN EXCELLENT JOB OF MAINTAINING EACH CHARACTER'S PERSONALITY. 💯😏👌💯
I love samspedy comedy. In fact it is my favourite comedy. So amazing and funny it is. Mama ojo, ojo and femi 😂🤣🤣🤣🤣😂😂😂. Ojo is the one who caused this problem between them
This was worth the wait omg...LMAO I was waiting for it and I love you guys my day starts out with watching and my granddaughter she' loves watching I watch the old videos over and over bring such laughter to my soul.
I really miss Grandma haha 😂 😂 she's here to settle the case I just love her 😍 😍 😍 Samspedy you really resemble your mom 😍😍😍😍 🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥 Na the background music day sweet me pass for the comedy😂😂😂😂😂
I love you guys for putting a smile on our faces ❤❤❤❤❤ Big up to Sam speedy and crew you're the best guys may God continues to bless you guys😍😍❤❤ love all the way from Zimbabwe 🇿🇼🇿🇼
That was more than a skit and educational programme... Thank. You so much man... You're amazing.... You play all roles so well.... You're editor is amazing👍👍that talent is amazing... Keep going
This guy can act. I still can’t believe it is the same person playing all these roles 👌🏾❤️
Eeeeeiiiii so his the same person as mama ojo😂😂😂woowww
That’s why he doesn’t upload that much
Ohh i know it i didn't know that,it was refusing me thanks
Me too
Swears❤️❤️❤️ can someone tell him how much I love him Sampedy❤️❤️❤️❤️❤️❤️❤️😩❤️
Love this attitude of Ojo 😂 I know it won’t last long.
Eh ojo
Keep it Sam team
time to get it tomorrow and prove to it yourself you want it yourself hair color for free nitarundisha me know when your prayers 🙏 I can get it tomorrow bye bye man
Soon he will taste that slap of fire 🔥
@@pufta5952 fb
Ojo will forever remain my favorite comedian,,,he is so talented God bless this guy🙏,,love from Kenya
BOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOORING
Vvvvvv😮😮😮😮❤❤❤❤
Ojo is one of the most creative content creator on RUclips, his videos are interesting every minute, kudos to his mom as well for doing such a good job of playing a role of Ojo's grandma and raising ojo in real life to be such creative,
Love from India 🇮🇳
Indeed, you can never get bored with his content
His names sam i think but hes fine with ojo :)
@@Flip-Playz his real name is Samuel Oluwafemi Osubiojo , so Sam or Ojo both are his real name ;)
REERKAKWKKWLWLALEAKRMKAKEJAKRLARKJALWLELKRKWJRKRELEKQLRAKEKARAKRLJSKWKWLWKRAJWLWLWKEKRLKSRLAWKALEKALRLWJRLSKEAJELAKEAEKRKAALWLWKELWEALWKKEWLLWEAWKKRJKSKEKEAKRKALWLEKALEAKRKSKSKEKEKKLEESLEAWKWLKWLLE
RRKSRLAKWAAEAKRSKWISKÀKKWKWLWKWAKEKKRMRKSKELS
R,AKKWWKKWKKEWRKARLSLWLEAWLWKAEKALWKWKWWWLLWKKWEKWKEAKRAWWRYKWLWKEARALWMALWKLWWKKRKWAKWKLQKW
RKWMWKWEYJLQQKQEKAKRAKAWKEKRNRJAKAJWWKEKWKKLWLLWLWRKEKEKAKWEKARNKAKAKWWKARAKWJEAWJKWWKWKKWKLWLLWRKRWEKAKEARKANAJAÀKWWKEKFKSWLKWKWKKEALWLAKE
RRKRAKWKRJAKWEKRJAKWKWEAWAKWWKKEKJWLELELWLW
10:13
GRANDMA’S SLAP CLEARED THE SITUATION😂😂🇷🇼
Hoooowwww i first reading this comment while watching the video . You spoiled the end🥺
Same
@@riazedn4728 he ruined it for me as well
@@SD__161 dat is klote
Komera 🇷🇼
OJOO I SALUTE U BRUU your work is exceptional I give you all the creditThis is like your calling bruuuuu
Mama ojo is packing🧳clothes she never wears. 😂😂😂😂😂always in one wrapper till Jesus returns.
HAHAHAHAHAHHAHAHA EXACTLY
Spot on
Excaty 😂😂😂😂😂😂
🤣🤣🤣🤣
🤣🤣🤣
This is the greatest comedy
He is the goat of comedy he deserves 50 million subscribers
That's kind of an exaggeration, don't you think?
At least 5 mil
Mark angel >
@@Ft237-x3q agreed
Sam you're amazing. I'm always scrolling my phone checking on RUclips for your videos . Each time I don't find any new ones , I feel bad. U have greatly improved.... Much Love from Uganda 🇺🇬💜
This guy is so in character that i really want to meet the whole family one day😂😂😂😊😂😂😂😂
Thanks for all may God bless dear
😄... I like your insanity.
Yep😁😁😁😁
the family is only ojo his mum is him his dad is him
😂😂😂same
Ojo looking bomb in that black swagg today🤩🤩🤩🤩🤩fine boy🤩🤩🤩
Shoga sikuwezi kila kona upo kumbe😆😇🥰🤌👌
@@salhamrisho8138 😂
@@salhamrisho8138 lll
👌🔥🔥
@@salhamrisho8138 🤣🤣🤣🤣acha tu shoga angu ,nakwambia sipitwi..kha!!hatari sana
The Advice given by the Grandmother to the parents is something we need to learn from. It is priceless👍👍
I love how ojo brings out the characters so well man you're talented
When Mama Ojo said "I brought you into this world", i sincerely thought she'd follow it with "And I can take you out of it" 🤣
same here.
🗣
Actuallyy!!!!
Exactly😂
A SLAP ALWAYS FIXES A ARGUMENT
This deserves an award... I have laughed 😂😂😂 keep it up SamSpedy. Good one
Ojo is bad on all aspects for real🤣🤣everything he does always affects people 🤣🤣🤣its that beating he's been missing for months🤣🤣🤣he never espererit🤣🤣🤣
truth na
@@shakurwonders5216 qà
yes it is call hit in the back
I love Ojo very much he dedicates himself to make sure we have a good day by keeping a smile on our faces
Sometimes I even forget he's the same person 😂. He's so good❤️
Ojo made a video please I love all your video
❤❤❤❤❤❤❤❤❤❤❤❤❤❤ 10:45 ❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤ 10:48 ❤❤❤❤❤❤❤❤❤❤❤❤ 10:48 ❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤😂😂❤❤❤❤❤❤❤❤❤
I really admired how African respect their older ones❣️❣️
It's grandma's reaction after ojo said we even have ghosts in this house for me 🤣🤣🤣 and the mama mama, papa papa part 🤣
Mr ojo when are u coming to Ghana 🇬🇭
Cos we would want to see u
Mr.ojo grandma's and after ojo said we even have ghosts in this house.🤓🤓🤓💔💔
so true.
She low key said " You say"
Wow
And absolute genius.
And my gosh he looks just like his mum. She’s also very talented.
A thousand 👏🏾
🙌🏾 yess
He os oneand the same person 😂😂😂😂
@@queenkariuki
I know
But his real mum is also in the skit. As the mother’s mother and mother in law...of the father, of which he plays both parts..
@@favourites9106 hi
@@mechamogaka6964 hi
Hahaha I done laugh 😂😂. Trie infant this one sweet me pass up to you mama ojo papa. Ojo and ojo too
Ojo and the cast deserve Grammy awards 🤣🤣🤣
So just Sam because he is Femi and His mom..?
Oscar*
He is the cast😂
For real 😳 give this man the trophy
@@whotheheckiseyosias his mom too dummy
I love this attitude of Ojo and I can’t believe Femi changed his attitude from being calm and nice to the same attitude just like Mama Ojo😂
Hopefully this attitude of Femi 😂😂😂 won’t change
I just don’t understand why anyone especially Femi and Mama Ojo would have a son who was a funny and delightful comedian but changed into a rude and disrespectful son
🤣 🤣 🤣 🤣 🤣 🤣 🤣
Ojo deserves it.
They switched attitudes lol
@@Whistlesonthewind just why 😂
I knew it was over when I saw there was no escape... and he realized it when he said "when I run this way".... it was over for it... but Ojo knew his life was about to end 😂😂😂😂 I love this guy so much...I can see him really making it big, Love from Kenya 🇰🇪
I never comment your videos Samspedy but with this masterpiece I can just recognize your huge talent. You are above many in your domain. Keep improving, I do really enjoy your videos and you deserve an Oscar👊🏾👏🏾
And he hardly comment but I love his content♥️
S
@@favouredblessed2631 ffdffff
What's going on ojo Is awesome 😎
He is the best 😜😊😊😊🤣 and the one 🕐 is it 😊
Ojo's channel needs to reach 5 million asap, gonna recommend his video to everyone ❤️
Very true
ight???? His vids are awesome
me too
He must also get verified
Sure!. Ojo life is finish! 😀
Ojo World wide, stellar acting performance from this man. Every character🌍👏👌
To be frank this guy is highly talented... His name should be included in the book of Legends 🔥
Spedy is a GENIUS!!!😂 And I love Grandma. She is so wise.❤
His real same is Sam not spedy hahah
@@its_Betty No one asked u though hahah
@@its_Betty His real same is Sam? SamSpedy, Sam or Spedy whatever... Give it up, it's not that serious
@@siahyoung6335 I never said it was fuck off my gosh always starting drama like this
@@sjjgamer4672 no one asked you
This man never disappoints 💯💯and I love how he's trying out new video edits like the slomo and the songs he chooses that fit a particular scene😩👌he is truly talented💯Love from Kenya🇰🇪
This matter is over now so he can't black mail you again 😂
Ojo really said “I don’t want peace, I want problems” when he sent the mum the picture 🤣🤣🤣🤣🤣🤣🤣love these videos
...and his life flashed before him. Goodbye indeed... 😄. Your mother is just fantastic in these skits. Her performance in this one especially was award-winning.
Mama ojo is the same character as papa ojo and ojo
I love how mama Ojo and papa Ojo joined forces at the end 🥺😂😂
Grandmother has great advice! Love this episode
The part he calls his grandma 👵🏽 and she didn’t pick it made me laugh and I said in my head that is killed🤣
@@prankmebiko1989 where's number five :( I was enjoying it 🙁
The song @ the end😂😂😂😂😂 #did I disappoint you😂😂😂
I always forget that mam Ojo has a beard.
This guy is so perfect in his acting. We love you Ojo💞 lots of love to your mum too, for being part of your acting 🌹🌹🌹
'
You really be mumu ojo🤣🤣🤣mumu man you will leave the house empty handed🤣🤣🤣
Hahahah ojo ur done
Legend bacon hair 2017
“Mama mama... daddy daddy...”
Mama, can't you forgive like daddy...does he have two heads”
😂😂🤣🤣
Hi
''Am I your oxygen?''
Hahaha!
I died!
🤣🤣🤣
This was hilarious!!!! At the end when they cornered Ojo, I was like, yaaaasssss, team work make the dream work😂😂😂😂👍
Ojo caused the trouble between his parents and actually solved it all by himself 😂😂😂😂
Right
Not all by himself his grandmother helped
@@preciousreally4361/mother
Lemme take this time and appreciate him literally the best comedian 💕💕☺️
The end was so funny, the way Ojo gave up was something else😂😂
The part that he said "we even have ghost in this house" got me off my bed from laughter 🤣🤣🤣
❤
No subscriber can say that this isn't the best we've seen ojo since the start of his RUclips career. Great job,ojo! Keep it up!
I've been waiting for this part 2 oohh , still can't believe its one person acting 3 roles😊😂
when she said let me get your handbag and just slapped her I was just laughing so hard also when he was ranting how he is faster and he realized it was a dead-end I burst out in laughter.
Just hilarious to see her packing her bag. Mama Ojo has an assortment of clothes but always wears one 😅🤣🤣🤣😭😭😭😭 HE DOES AN EXCELLENT JOB OF MAINTAINING EACH CHARACTER'S PERSONALITY. 💯😏👌💯
Da way she doesn't change
🤣😂
🤣🤣🤣
😂😂
0w
I swear this guy makes my day every time he uploads vids 😭 ❤️ ❤️
fr
onggg
Fr😩❤️❤️❤️
Me to
Exacly
Mama Ojo u dey make me laugh himmmmm .. your acting is so real as if you're brought into this world to make people laugh 😂😂😂
18:37
The way Ojo just sat down and accepted defeat…..
What a warrior!!🥲
RIP ojo
Ojo will always be his mom's hand bag 👜 😂😂😂😂
Hi dm shavic
😊
You are bringing Nigerian film industry back to life. More love from Kenya
🥰🥰😍
am early enough today....🙏🙏🤣🤣good job ojo and your panel ...We as Kenyans 🇰🇪🇰🇪🇰🇪do really enjoy your videos 🤣🤣
I like how he never stops trying to blackmail them
I know
@@prankmebiko1989 bruh no one asked 💀
😂😂
🤣🤣🤣🤣🤣🤣🤣🤣🤣
@@prankmebiko1989 😏
I really love watching this man's videos ,,really creative,, lots of love from Kenya ojo
I haven’t watched it yet but I already know that I am going to be dying of laughter 😭😭
So true😭😩
Why y telling comments then when u haven’t watch it yet
The ending is everything that's stand for greatness in this video😂
I was watching this channel for over 2 years and I figured out that ojo can be very smart
Genius absolute genius! 😂The last part of Ojo between his parents finished me and the background song🤣🤣🤣🤣 I can't stop laughing😂😂😂😂
The facial expressions alone especially at the end was a masterpiece 😄Samspeeeedyyyy👏👏👏👏👏👏👏👏
I love samspedy comedy. In fact it is my favourite comedy. So amazing and funny it is. Mama ojo, ojo and femi 😂🤣🤣🤣🤣😂😂😂. Ojo is the one who caused this problem between them
This was worth the wait omg...LMAO I was waiting for it and I love you guys my day starts out with watching and my granddaughter she' loves watching I watch the old videos over and over bring such laughter to my soul.
I wasn't having a good day today until I watched Ojo he made me laugh soo much. im grateful for him and his content
I have been watching Ojo for 2 years and boy he makes me laugh.
This is by far he’s best episode of the year 🔥🔥💯🎯 idk what anyone says or does this is the one (2022) ALL PROPS TO SAM!!! 😂 very enjoyable!
🤣🤣🤣🤣🤣😂🙆🏾♂️ Everything is in this house 🏡, we even have ghost 👻 in this house 🏡. Grandma 👵 face mmm when she heard ghost 👻 is in this house.
Very creative scene ,,,always best Sam #mamaojo,,Great🥰❤❤🔥🔥💪💪
Right on time this round 😂😂😂 why is Eunice always shaking her legs while sitting down kwanu?
Lolzz😁. Finally, he exposed the parents secrets individually. I'm always curious and enthralled to the continuation of the story.
i just needed a reason to subscribe and hit the notification bell. Mad respect from Kenya😃🤜
Best episode!!! 😂😂😂 When he couldn't even call Grandma back I was CRACKING up!!! 🤣🤣🤣
he was blocked!!! 🤣
I really miss Grandma haha 😂 😂 she's here to settle the case I just love her 😍 😍 😍 Samspedy you really resemble your mom 😍😍😍😍 🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥 Na the background music day sweet me pass for the comedy😂😂😂😂😂
Ikk 😂😂🥰
Yes that part
That's true❤❤
Ojo you are so funny keep up the good work
The part when femi said ' dont forget to take your son with you ' I literally died
Hbic from
We even have ghosts in this house best part🤣🤣😂😂😂
BLACKMAILER Part 2, baby! Absolutely love it!! But beginning and ending killed me🤣🤣🤣🤣💖🤣🤣
I love you guys for putting a smile on our faces ❤❤❤❤❤ Big up to Sam speedy and crew you're the best guys may God continues to bless you guys😍😍❤❤ love all the way from Zimbabwe 🇿🇼🇿🇼
oh Lord i laughed so much for this episode. Ojo never learns. you just cant win against Mama Ojo. 🤣🤣🤣🤣🤣🤣🤣 awesome content dude. 💖💖💖💖💖💖💖
That was more than a skit and educational programme... Thank. You so much man... You're amazing.... You play all roles so well.... You're editor is amazing👍👍that talent is amazing... Keep going
It's the way Ojo's fate was sealed at the ending, hommies knew he was done for once femi showed up, he literally said "wow" 😂😂😂😂😂😂😂😂
i knew it too like hes done for
Lol
The hand movement after the "Don't forget to take your son with you" part 😂😂😂
The song kills me and the part mama papa , do you think you can catch me?😅😅😅😂😂😂😂
I love how ojo jus sat down and accept his fate he knew he lost the minute he saw his father. ojo was probably saying in his mind Game Over.
😂😂😂
That was exactly how I wanted it to end😂😂😂😂
This is not just comedy but it dey advice us as well..thanks Samspeedy
I just discovered a new talent,love your acting,all the way from uganda
I really miss Grandma haha 😂 😂 she's here to settle the case I just love her 😍 😍 😍 😍 😍 😍
Ojo u are so creative I love all your videos
Each time I watch them It always puts a smile on my face😹😹😹 keep up the good work
Our sam never disappoints us he is the best
FRR
Ojo I know is hard but we really need more of this videos
They were really fast in catching Ojo at the last part😀😀
It’s ojo sitting calmly in the Sofa while his parents are giving it to each other for me 😂😂
😂😂😂😂😂😂😂😂
fsggz ...yuyeueus❤ ishwji😂😂😂😂hdkjsjujskdkkjhej. jwiwiwoiiw
😂😂😂😂😂
I'm laughing like a mad man in the living room. God bless you Ojo!!!😂😂😂😭😭😭😭
Sampedy is the best actor, And I like his comedies very much it put a smile on my face
First one from Guinea 🇬🇳 thanks ojo to make us happy 😂👊🏾
I’m watching now 😂😂
Ojo has me laughing soo hard every time he uploads😂😂😂
I love the way he acts he's a pro. Acting three roles is not a joke
I have been a fun of ojo since 2017
So nice to see him try new things
Ojo needs a golden trofy for his hard work 💘💘💘👌👌👏👏👏👏👏👏👏👏👏🤘🤘🤘🤘🤘👍👍
I like how mama ojo has a suitcase of clothes but only wears one outfit 😭😭😭
🤣🤣🤣🤣🤣🤣
😅😅😅
The part when he said "Try to forgive and forget like daddy - does he have two heads?' got me laughing so much 🤣🤣🤣🤣 Ojo doesn't disappoint
I Didn’t really get that joke.
what does that mean🤣
@@arlynheaven9962😂😂