AFRICAN HOME: THE BLACKMAILER (EPISODE 2)

Поделиться
HTML-код
  • Опубликовано: 20 янв 2025

Комментарии • 3,6 тыс.

  • @herlife3526
    @herlife3526 2 года назад +1790

    This guy can act. I still can’t believe it is the same person playing all these roles 👌🏾❤️

    • @sorfomaame4360
      @sorfomaame4360 2 года назад +47

      Eeeeeiiiii so his the same person as mama ojo😂😂😂woowww

    • @RealKxng
      @RealKxng 2 года назад +34

      That’s why he doesn’t upload that much

    • @atwinecaroline7324
      @atwinecaroline7324 2 года назад +14

      Ohh i know it i didn't know that,it was refusing me thanks

    • @fatmatakeita1876
      @fatmatakeita1876 2 года назад +5

      Me too

    • @kwesiayepa3448
      @kwesiayepa3448 2 года назад +8

      Swears❤️❤️❤️ can someone tell him how much I love him Sampedy❤️❤️❤️❤️❤️❤️❤️😩❤️

  • @AnnuSia
    @AnnuSia 2 года назад +891

    Love this attitude of Ojo 😂 I know it won’t last long.

    • @pufta5952
      @pufta5952 2 года назад +5

      Eh ojo

    • @thomasshihango4726
      @thomasshihango4726 2 года назад +3

      Keep it Sam team

    • @irenenjuguna6623
      @irenenjuguna6623 2 года назад +1

      time to get it tomorrow and prove to it yourself you want it yourself hair color for free nitarundisha me know when your prayers 🙏 I can get it tomorrow bye bye man

    • @jaishankar5094
      @jaishankar5094 2 года назад +3

      Soon he will taste that slap of fire 🔥

    • @jaysonmundia6388
      @jaysonmundia6388 2 года назад

      @@pufta5952 fb

  • @denniskamau5656
    @denniskamau5656 2 года назад +72

    Ojo will forever remain my favorite comedian,,,he is so talented God bless this guy🙏,,love from Kenya

    • @virginiawanjiru7248
      @virginiawanjiru7248 11 месяцев назад +2

      BOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOORING

    • @dekosmalo
      @dekosmalo 26 дней назад +1

      Vvvvvv😮😮😮😮❤❤❤❤

  • @Itsluminarywealth
    @Itsluminarywealth 2 года назад +497

    Ojo is one of the most creative content creator on RUclips, his videos are interesting every minute, kudos to his mom as well for doing such a good job of playing a role of Ojo's grandma and raising ojo in real life to be such creative,
    Love from India 🇮🇳

    • @GXQ42
      @GXQ42 2 года назад +9

      Indeed, you can never get bored with his content

    • @Flip-Playz
      @Flip-Playz 2 года назад +2

      His names sam i think but hes fine with ojo :)

    • @Itsluminarywealth
      @Itsluminarywealth 2 года назад +11

      @@Flip-Playz his real name is Samuel Oluwafemi Osubiojo , so Sam or Ojo both are his real name ;)

    • @AderomoluAdeyeri
      @AderomoluAdeyeri 18 дней назад

      REERKAKWKKWLWLALEAKRMKAKEJAKRLARKJALWLELKRKWJRKRELEKQLRAKEKARAKRLJSKWKWLWKRAJWLWLWKEKRLKSRLAWKALEKALRLWJRLSKEAJELAKEAEKRKAALWLWKELWEALWKKEWLLWEAWKKRJKSKEKEAKRKALWLEKALEAKRKSKSKEKEKKLEESLEAWKWLKWLLE
      RRKSRLAKWAAEAKRSKWISKÀKKWKWLWKWAKEKKRMRKSKELS

    • @AderomoluAdeyeri
      @AderomoluAdeyeri 18 дней назад

      R,AKKWWKKWKKEWRKARLSLWLEAWLWKAEKALWKWKWWWLLWKKWEKWKEAKRAWWRYKWLWKEARALWMALWKLWWKKRKWAKWKLQKW
      RKWMWKWEYJLQQKQEKAKRAKAWKEKRNRJAKAJWWKEKWKKLWLLWLWRKEKEKAKWEKARNKAKAKWWKARAKWJEAWJKWWKWKKWKLWLLWRKRWEKAKEARKANAJAÀKWWKEKFKSWLKWKWKKEALWLAKE
      RRKRAKWKRJAKWEKRJAKWKWEAWAKWWKKEKJWLELELWLW
      10:13

  • @Animatevr
    @Animatevr 2 года назад +708

    GRANDMA’S SLAP CLEARED THE SITUATION😂😂🇷🇼

    • @riazedn4728
      @riazedn4728 2 года назад +19

      Hoooowwww i first reading this comment while watching the video . You spoiled the end🥺

    • @SD__161
      @SD__161 2 года назад +6

      Same

    • @SD__161
      @SD__161 2 года назад +4

      @@riazedn4728 he ruined it for me as well

    • @riazedn4728
      @riazedn4728 2 года назад +1

      @@SD__161 dat is klote

    • @emelyneza
      @emelyneza 2 года назад +3

      Komera 🇷🇼

  • @mkhayoz1686
    @mkhayoz1686 2 года назад +4

    OJOO I SALUTE U BRUU your work is exceptional I give you all the creditThis is like your calling bruuuuu

  • @VGTV578
    @VGTV578 2 года назад +176

    Mama ojo is packing🧳clothes she never wears. 😂😂😂😂😂always in one wrapper till Jesus returns.

  • @zackattack9673
    @zackattack9673 2 года назад +187

    This is the greatest comedy
    He is the goat of comedy he deserves 50 million subscribers

    • @angeloann5945
      @angeloann5945 2 года назад +1

      That's kind of an exaggeration, don't you think?

    • @yes9515
      @yes9515 2 года назад +1

      At least 5 mil

    • @Ft237-x3q
      @Ft237-x3q 2 года назад

      Mark angel >

    • @yes9515
      @yes9515 2 года назад +1

      @@Ft237-x3q agreed

  • @tracynoel9065
    @tracynoel9065 2 года назад +21

    Sam you're amazing. I'm always scrolling my phone checking on RUclips for your videos . Each time I don't find any new ones , I feel bad. U have greatly improved.... Much Love from Uganda 🇺🇬💜

  • @young_justice
    @young_justice 2 года назад +614

    This guy is so in character that i really want to meet the whole family one day😂😂😂😊😂😂😂😂

  • @kekiplus1andonly
    @kekiplus1andonly 2 года назад +143

    Ojo looking bomb in that black swagg today🤩🤩🤩🤩🤩fine boy🤩🤩🤩

    • @salhamrisho8138
      @salhamrisho8138 2 года назад +4

      Shoga sikuwezi kila kona upo kumbe😆😇🥰🤌👌

    • @JanetRosesB
      @JanetRosesB 2 года назад +3

      @@salhamrisho8138 😂

    • @fabiolajohnson2039
      @fabiolajohnson2039 2 года назад +2

      @@salhamrisho8138 lll

    • @KeelsM.
      @KeelsM. 2 года назад +2

      👌🔥🔥

    • @kekiplus1andonly
      @kekiplus1andonly 2 года назад +2

      @@salhamrisho8138 🤣🤣🤣🤣acha tu shoga angu ,nakwambia sipitwi..kha!!hatari sana

  • @deinmadiri1010
    @deinmadiri1010 2 года назад +13

    The Advice given by the Grandmother to the parents is something we need to learn from. It is priceless👍👍

  • @eunicevugutsa9218
    @eunicevugutsa9218 2 года назад +51

    I love how ojo brings out the characters so well man you're talented

  • @mojisoladeji
    @mojisoladeji 2 года назад +388

    When Mama Ojo said "I brought you into this world", i sincerely thought she'd follow it with "And I can take you out of it" 🤣

  • @meraboyugi7110
    @meraboyugi7110 2 года назад +14

    This deserves an award... I have laughed 😂😂😂 keep it up SamSpedy. Good one

  • @kekiplus1andonly
    @kekiplus1andonly 2 года назад +188

    Ojo is bad on all aspects for real🤣🤣everything he does always affects people 🤣🤣🤣its that beating he's been missing for months🤣🤣🤣he never espererit🤣🤣🤣

  • @maureenwaithera6553
    @maureenwaithera6553 2 года назад +108

    I love Ojo very much he dedicates himself to make sure we have a good day by keeping a smile on our faces

    • @nuellalaryea9775
      @nuellalaryea9775 2 года назад +2

      Sometimes I even forget he's the same person 😂. He's so good❤️

    • @jaylongoodridge3386
      @jaylongoodridge3386 2 года назад +3

      Ojo made a video please I love all your video

    • @FatouGaye-d6c
      @FatouGaye-d6c 9 месяцев назад

      ❤❤❤❤❤❤❤❤❤❤❤❤❤❤ 10:45 ❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤ 10:48 ❤❤❤❤❤❤❤❤❤❤❤❤ 10:48 ❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤😂😂❤❤❤❤❤❤❤❤❤

  • @Reuben8974
    @Reuben8974 2 года назад +16

    I really admired how African respect their older ones❣️❣️

  • @febbieknsenga481
    @febbieknsenga481 2 года назад +312

    It's grandma's reaction after ojo said we even have ghosts in this house for me 🤣🤣🤣 and the mama mama, papa papa part 🤣

    • @kofiyesu3446
      @kofiyesu3446 2 года назад +7

      Mr ojo when are u coming to Ghana 🇬🇭
      Cos we would want to see u

    • @innocenteakpabla8265
      @innocenteakpabla8265 2 года назад +5

      Mr.ojo grandma's and after ojo said we even have ghosts in this house.🤓🤓🤓💔💔

    • @warissulub8793
      @warissulub8793 2 года назад +1

      so true.

    • @peaceofori8063
      @peaceofori8063 2 года назад +1

      She low key said " You say"

    • @yewandegiwa7199
      @yewandegiwa7199 2 года назад +2

      Wow

  • @favourites9106
    @favourites9106 2 года назад +84

    And absolute genius.
    And my gosh he looks just like his mum. She’s also very talented.
    A thousand 👏🏾

    • @mechamogaka6964
      @mechamogaka6964 2 года назад +1

      🙌🏾 yess

    • @queenkariuki
      @queenkariuki 2 года назад +2

      He os oneand the same person 😂😂😂😂

    • @favourites9106
      @favourites9106 2 года назад

      @@queenkariuki
      I know
      But his real mum is also in the skit. As the mother’s mother and mother in law...of the father, of which he plays both parts..

    • @adnen7944
      @adnen7944 2 года назад +1

      @@favourites9106 hi

    • @adnen7944
      @adnen7944 2 года назад

      @@mechamogaka6964 hi

  • @UjunwaBlessingOkonkwo-rr1pq
    @UjunwaBlessingOkonkwo-rr1pq 7 месяцев назад +2

    Hahaha I done laugh 😂😂. Trie infant this one sweet me pass up to you mama ojo papa. Ojo and ojo too

  • @Scenes04
    @Scenes04 2 года назад +187

    Ojo and the cast deserve Grammy awards 🤣🤣🤣

    • @whotheheckiseyosias
      @whotheheckiseyosias 2 года назад

      So just Sam because he is Femi and His mom..?

    • @IllaDillaJ
      @IllaDillaJ 2 года назад +5

      Oscar*

    • @joshola353
      @joshola353 2 года назад +4

      He is the cast😂

    • @mechamogaka6964
      @mechamogaka6964 2 года назад

      For real 😳 give this man the trophy

    • @ch4is
      @ch4is 2 года назад

      @@whotheheckiseyosias his mom too dummy

  • @nathanluzitu7360
    @nathanluzitu7360 2 года назад +223

    I love this attitude of Ojo and I can’t believe Femi changed his attitude from being calm and nice to the same attitude just like Mama Ojo😂
    Hopefully this attitude of Femi 😂😂😂 won’t change
    I just don’t understand why anyone especially Femi and Mama Ojo would have a son who was a funny and delightful comedian but changed into a rude and disrespectful son

  • @melariccapatton2423
    @melariccapatton2423 2 года назад +28

    I knew it was over when I saw there was no escape... and he realized it when he said "when I run this way".... it was over for it... but Ojo knew his life was about to end 😂😂😂😂 I love this guy so much...I can see him really making it big, Love from Kenya 🇰🇪

  • @espoirahouissou3078
    @espoirahouissou3078 2 года назад +291

    I never comment your videos Samspedy but with this masterpiece I can just recognize your huge talent. You are above many in your domain. Keep improving, I do really enjoy your videos and you deserve an Oscar👊🏾👏🏾

    • @favouredblessed2631
      @favouredblessed2631 2 года назад +3

      And he hardly comment but I love his content♥️

    • @sofiaasino1034
      @sofiaasino1034 2 года назад +1

      S

    • @sofiaasino1034
      @sofiaasino1034 2 года назад +1

      @@favouredblessed2631 ffdffff

    • @curls1090
      @curls1090 2 года назад +1

      What's going on ojo Is awesome 😎

    • @curls1090
      @curls1090 2 года назад +1

      He is the best 😜😊😊😊🤣 and the one 🕐 is it 😊

  • @Itsluminarywealth
    @Itsluminarywealth 2 года назад +96

    Ojo's channel needs to reach 5 million asap, gonna recommend his video to everyone ❤️

  • @emmanuelalimetikitutu7331
    @emmanuelalimetikitutu7331 2 года назад +5

    Ojo World wide, stellar acting performance from this man. Every character🌍👏👌

  • @jackwinnerhustler5576
    @jackwinnerhustler5576 2 года назад +86

    To be frank this guy is highly talented... His name should be included in the book of Legends 🔥

  • @brookelynne6888
    @brookelynne6888 2 года назад +103

    Spedy is a GENIUS!!!😂 And I love Grandma. She is so wise.❤

    • @its_Betty
      @its_Betty 2 года назад +2

      His real same is Sam not spedy hahah

    • @sjjgamer4672
      @sjjgamer4672 2 года назад +1

      @@its_Betty No one asked u though hahah

    • @siahyoung6335
      @siahyoung6335 2 года назад +1

      @@its_Betty His real same is Sam? SamSpedy, Sam or Spedy whatever... Give it up, it's not that serious

    • @its_Betty
      @its_Betty 2 года назад

      @@siahyoung6335 I never said it was fuck off my gosh always starting drama like this

    • @xxmercedex
      @xxmercedex 2 года назад

      @@sjjgamer4672 no one asked you

  • @cynthiamuiru4799
    @cynthiamuiru4799 2 года назад +156

    This man never disappoints 💯💯and I love how he's trying out new video edits like the slomo and the songs he chooses that fit a particular scene😩👌he is truly talented💯Love from Kenya🇰🇪

    • @veronicaharry7581
      @veronicaharry7581 Год назад +1

      This matter is over now so he can't black mail you again 😂

  • @LyricVideos-rp2wf
    @LyricVideos-rp2wf 2 года назад +145

    Ojo really said “I don’t want peace, I want problems” when he sent the mum the picture 🤣🤣🤣🤣🤣🤣🤣love these videos

  • @tashnahtv6098
    @tashnahtv6098 2 года назад +42

    ...and his life flashed before him. Goodbye indeed... 😄. Your mother is just fantastic in these skits. Her performance in this one especially was award-winning.

  • @annek9231
    @annek9231 2 года назад +38

    I love how mama Ojo and papa Ojo joined forces at the end 🥺😂😂

  • @missdunn7439
    @missdunn7439 2 года назад +13

    Grandmother has great advice! Love this episode

  • @ekemodeaminat_1
    @ekemodeaminat_1 2 года назад +87

    The part he calls his grandma 👵🏽 and she didn’t pick it made me laugh and I said in my head that is killed🤣

    • @nolxve_amari2918
      @nolxve_amari2918 2 года назад +2

      @@prankmebiko1989 where's number five :( I was enjoying it 🙁

  • @EfphyaDinky
    @EfphyaDinky Год назад +1

    The song @ the end😂😂😂😂😂 #did I disappoint you😂😂😂

  • @mariont2961
    @mariont2961 2 года назад +46

    I always forget that mam Ojo has a beard.
    This guy is so perfect in his acting. We love you Ojo💞 lots of love to your mum too, for being part of your acting 🌹🌹🌹

  • @kekiplus1andonly
    @kekiplus1andonly 2 года назад +51

    You really be mumu ojo🤣🤣🤣mumu man you will leave the house empty handed🤣🤣🤣

  • @arsports8
    @arsports8 2 года назад +40

    “Mama mama... daddy daddy...”
    Mama, can't you forgive like daddy...does he have two heads”
    😂😂🤣🤣

  • @Zappercraft21
    @Zappercraft21 2 года назад +28

    ''Am I your oxygen?''
    Hahaha!
    I died!
    🤣🤣🤣

  • @sandismith9909
    @sandismith9909 2 года назад +52

    This was hilarious!!!! At the end when they cornered Ojo, I was like, yaaaasssss, team work make the dream work😂😂😂😂👍

  • @hellensingoey2269
    @hellensingoey2269 2 года назад +100

    Ojo caused the trouble between his parents and actually solved it all by himself 😂😂😂😂

  • @uwasedorcas1292
    @uwasedorcas1292 2 года назад +52

    Lemme take this time and appreciate him literally the best comedian 💕💕☺️

  • @Pretty.Og1
    @Pretty.Og1 2 года назад +26

    The end was so funny, the way Ojo gave up was something else😂😂

  • @christoliteotoo3486
    @christoliteotoo3486 2 года назад +54

    The part that he said "we even have ghost in this house" got me off my bed from laughter 🤣🤣🤣

  • @ramirondongmba2365
    @ramirondongmba2365 2 года назад +35

    No subscriber can say that this isn't the best we've seen ojo since the start of his RUclips career. Great job,ojo! Keep it up!

  • @vanessawilson4190
    @vanessawilson4190 2 года назад +17

    I've been waiting for this part 2 oohh , still can't believe its one person acting 3 roles😊😂

  • @theplum5047
    @theplum5047 2 года назад +31

    when she said let me get your handbag and just slapped her I was just laughing so hard also when he was ranting how he is faster and he realized it was a dead-end I burst out in laughter.

  • @jenelleewing2441
    @jenelleewing2441 2 года назад +100

    Just hilarious to see her packing her bag. Mama Ojo has an assortment of clothes but always wears one 😅🤣🤣🤣😭😭😭😭 HE DOES AN EXCELLENT JOB OF MAINTAINING EACH CHARACTER'S PERSONALITY. 💯😏👌💯

  • @Therocksso
    @Therocksso 2 года назад +102

    I swear this guy makes my day every time he uploads vids 😭 ❤️ ❤️

  • @hildajohn3065
    @hildajohn3065 2 года назад +1

    Mama Ojo u dey make me laugh himmmmm .. your acting is so real as if you're brought into this world to make people laugh 😂😂😂

  • @frredhappymonsterband8635
    @frredhappymonsterband8635 2 года назад +75

    18:37
    The way Ojo just sat down and accepted defeat…..
    What a warrior!!🥲

  • @dmshavic7114
    @dmshavic7114 2 года назад +104

    Ojo will always be his mom's hand bag 👜 😂😂😂😂

  • @peterbrooks9543
    @peterbrooks9543 2 года назад +5

    You are bringing Nigerian film industry back to life. More love from Kenya

  • @lizz6555
    @lizz6555 2 года назад +8

    am early enough today....🙏🙏🤣🤣good job ojo and your panel ...We as Kenyans 🇰🇪🇰🇪🇰🇪do really enjoy your videos 🤣🤣

  • @layourd6266
    @layourd6266 2 года назад +79

    I like how he never stops trying to blackmail them

  • @muthokielizabeth-po6zs
    @muthokielizabeth-po6zs Год назад

    I really love watching this man's videos ,,really creative,, lots of love from Kenya ojo

  • @emilyscott3011
    @emilyscott3011 2 года назад +51

    I haven’t watched it yet but I already know that I am going to be dying of laughter 😭😭

  • @cyphusstanislaus
    @cyphusstanislaus 2 года назад +38

    The ending is everything that's stand for greatness in this video😂

  • @saabrenelhaddad1776
    @saabrenelhaddad1776 2 года назад +10

    I was watching this channel for over 2 years and I figured out that ojo can be very smart

  • @FlorenceSomses
    @FlorenceSomses 2 года назад +16

    Genius absolute genius! 😂The last part of Ojo between his parents finished me and the background song🤣🤣🤣🤣 I can't stop laughing😂😂😂😂

  • @kukuaekuban997
    @kukuaekuban997 2 года назад +12

    The facial expressions alone especially at the end was a masterpiece 😄Samspeeeedyyyy👏👏👏👏👏👏👏👏

  • @jaliamwajuma1378
    @jaliamwajuma1378 Год назад

    I love samspedy comedy. In fact it is my favourite comedy. So amazing and funny it is. Mama ojo, ojo and femi 😂🤣🤣🤣🤣😂😂😂. Ojo is the one who caused this problem between them

  • @veraclemmons3659
    @veraclemmons3659 2 года назад +16

    This was worth the wait omg...LMAO I was waiting for it and I love you guys my day starts out with watching and my granddaughter she' loves watching I watch the old videos over and over bring such laughter to my soul.

  • @malyeskante1700
    @malyeskante1700 2 года назад +38

    I wasn't having a good day today until I watched Ojo he made me laugh soo much. im grateful for him and his content

  • @tyrique4862
    @tyrique4862 2 года назад +8

    I have been watching Ojo for 2 years and boy he makes me laugh.

  • @mechamogaka6964
    @mechamogaka6964 2 года назад +25

    This is by far he’s best episode of the year 🔥🔥💯🎯 idk what anyone says or does this is the one (2022) ALL PROPS TO SAM!!! 😂 very enjoyable!

  • @deduels7948
    @deduels7948 2 года назад +15

    🤣🤣🤣🤣🤣😂🙆🏾‍♂️ Everything is in this house 🏡, we even have ghost 👻 in this house 🏡. Grandma 👵 face mmm when she heard ghost 👻 is in this house.

  • @jameskathoka4859
    @jameskathoka4859 2 года назад +1

    Very creative scene ,,,always best Sam #mamaojo,,Great🥰❤❤🔥🔥💪💪

  • @alexnyotumba9247
    @alexnyotumba9247 2 года назад +28

    Right on time this round 😂😂😂 why is Eunice always shaking her legs while sitting down kwanu?

  • @chinonyeihenetu4523
    @chinonyeihenetu4523 2 года назад +6

    Lolzz😁. Finally, he exposed the parents secrets individually. I'm always curious and enthralled to the continuation of the story.

  • @kingndedaprofits6725
    @kingndedaprofits6725 2 года назад +2

    i just needed a reason to subscribe and hit the notification bell. Mad respect from Kenya😃🤜

  • @lyricwilberg
    @lyricwilberg 2 года назад +52

    Best episode!!! 😂😂😂 When he couldn't even call Grandma back I was CRACKING up!!! 🤣🤣🤣

  • @tallman-tv4049
    @tallman-tv4049 2 года назад +64

    I really miss Grandma haha 😂 😂 she's here to settle the case I just love her 😍 😍 😍 Samspedy you really resemble your mom 😍😍😍😍 🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥 Na the background music day sweet me pass for the comedy😂😂😂😂😂

  • @alifasalami1751
    @alifasalami1751 2 года назад +2

    Ojo you are so funny keep up the good work

  • @zahariahjoe1357
    @zahariahjoe1357 2 года назад +43

    The part when femi said ' dont forget to take your son with you ' I literally died

  • @kristal9081
    @kristal9081 2 года назад +14

    We even have ghosts in this house best part🤣🤣😂😂😂

  • @mpanamashile3901
    @mpanamashile3901 2 года назад +1

    BLACKMAILER Part 2, baby! Absolutely love it!! But beginning and ending killed me🤣🤣🤣🤣💖🤣🤣

  • @stephiezvidzayi943
    @stephiezvidzayi943 2 года назад +28

    I love you guys for putting a smile on our faces ❤❤❤❤❤ Big up to Sam speedy and crew you're the best guys may God continues to bless you guys😍😍❤❤ love all the way from Zimbabwe 🇿🇼🇿🇼

  • @carlamatthew3681
    @carlamatthew3681 2 года назад +9

    oh Lord i laughed so much for this episode. Ojo never learns. you just cant win against Mama Ojo. 🤣🤣🤣🤣🤣🤣🤣 awesome content dude. 💖💖💖💖💖💖💖

  • @namuliregina2156
    @namuliregina2156 2 года назад

    That was more than a skit and educational programme... Thank. You so much man... You're amazing.... You play all roles so well.... You're editor is amazing👍👍that talent is amazing... Keep going

  • @thatimmortal
    @thatimmortal 2 года назад +135

    It's the way Ojo's fate was sealed at the ending, hommies knew he was done for once femi showed up, he literally said "wow" 😂😂😂😂😂😂😂😂

  • @dlangisa1525
    @dlangisa1525 2 года назад +31

    The hand movement after the "Don't forget to take your son with you" part 😂😂😂

  • @lindokuhleknowledge6574
    @lindokuhleknowledge6574 2 года назад

    The song kills me and the part mama papa , do you think you can catch me?😅😅😅😂😂😂😂

  • @adriancurrie6213
    @adriancurrie6213 2 года назад +34

    I love how ojo jus sat down and accept his fate he knew he lost the minute he saw his father. ojo was probably saying in his mind Game Over.

  • @kwekuwina
    @kwekuwina 2 года назад +4

    This is not just comedy but it dey advice us as well..thanks Samspeedy

  • @jackline6195
    @jackline6195 2 года назад

    I just discovered a new talent,love your acting,all the way from uganda

  • @amoahanastasia1978
    @amoahanastasia1978 2 года назад +40

    I really miss Grandma haha 😂 😂 she's here to settle the case I just love her 😍 😍 😍 😍 😍 😍

  • @efiandemfonjie2434
    @efiandemfonjie2434 2 года назад +5

    Ojo u are so creative I love all your videos
    Each time I watch them It always puts a smile on my face😹😹😹 keep up the good work

  • @navya2235
    @navya2235 2 года назад +36

    Our sam never disappoints us he is the best

  • @leonardderkyi-kwarteng-p2b
    @leonardderkyi-kwarteng-p2b Год назад +1

    They were really fast in catching Ojo at the last part😀😀

  • @thee_heavens1401
    @thee_heavens1401 2 года назад +34

    It’s ojo sitting calmly in the Sofa while his parents are giving it to each other for me 😂😂

    • @NANCYMutegi-rk6ti
      @NANCYMutegi-rk6ti Год назад +2

      😂😂😂😂😂😂😂😂

    • @OryxOil
      @OryxOil 3 месяца назад

      fsggz ...yuyeueus❤ ishwji😂😂😂😂hdkjsjujskdkkjhej. jwiwiwoiiw

  • @d.a.dstudios7274
    @d.a.dstudios7274 2 года назад +13

    😂😂😂😂😂
    I'm laughing like a mad man in the living room. God bless you Ojo!!!😂😂😂😭😭😭😭

  • @fatousanneh6620
    @fatousanneh6620 2 года назад

    Sampedy is the best actor, And I like his comedies very much it put a smile on my face

  • @MohamedAl02
    @MohamedAl02 2 года назад +7

    First one from Guinea 🇬🇳 thanks ojo to make us happy 😂👊🏾
    I’m watching now 😂😂

  • @iamwainaina
    @iamwainaina 2 года назад +15

    Ojo has me laughing soo hard every time he uploads😂😂😂

  • @philomenamwisa9132
    @philomenamwisa9132 2 года назад +1

    I love the way he acts he's a pro. Acting three roles is not a joke

  • @queendior5174
    @queendior5174 2 года назад +9

    I have been a fun of ojo since 2017
    So nice to see him try new things
    Ojo needs a golden trofy for his hard work 💘💘💘👌👌👏👏👏👏👏👏👏👏👏🤘🤘🤘🤘🤘👍👍

  • @Dylan-ii5es
    @Dylan-ii5es 2 года назад +73

    I like how mama ojo has a suitcase of clothes but only wears one outfit 😭😭😭

  • @emmanueldavidmusic3217
    @emmanueldavidmusic3217 2 года назад +33

    The part when he said "Try to forgive and forget like daddy - does he have two heads?' got me laughing so much 🤣🤣🤣🤣 Ojo doesn't disappoint