![CookieYes](/img/default-banner.jpg)
- Видео 84
- Просмотров 258 517
CookieYes
Индия
Добавлен 7 ноя 2019
CookieYes is a GDPR and CCPA cookie consent solution for your website. We power over a million websites, small and large business alike, for cookie compliance.
Subscribe to our channel for product demos and informational videos.
Learn more about us at www.cookieyes.com
Subscribe to our channel for product demos and informational videos.
Learn more about us at www.cookieyes.com
How to Transfer a Site in Your CookieYes Account?
In this video, we’ll walk you through the simple process of transferring a site in your CookieYes account. Whether you're moving a site to a different organization or transferring it to another user's account, our step-by-step guide will ensure a seamless transition without any data loss.
Check out the detailed help guide: www.cookieyes.com/documentation/transfer-a-site/?ref=transfer_yt
Check out the detailed help guide: www.cookieyes.com/documentation/transfer-a-site/?ref=transfer_yt
Просмотров: 19
Видео
How to Change Account Owner in CookieYes?
Просмотров 54День назад
In this video, we'll walk you through the simple steps to change the account owner in your CookieYes account. This process is designed to ensure a seamless transition of ownership with minimal hassle. Check out the detailed help guide: www.cookieyes.com/documentation/change-account-owner-2/?ref=changeacc_yt
Set Up Consent Mode v2 Without Google Tag Manager
Просмотров 18314 дней назад
Learn to implement Google Consent Mode v2 easily without the hassle of complex coding or Google Tag Manager. Check out our detailed help guide for the custom consent mode script details: www.cookieyes.com/documentation/integrate-gcm-for-google-services-without-gtm/?ref=gcmwtm-yt Guide to verify GCM integration: www.cookieyes.com/documentation/check-proper-implementation-of-gcm/?ref=gcmwtm-yt
Roles and Permissions in CookieYes WebApp
Просмотров 11321 день назад
In this video, we’ll walk you through the different access roles and permissions available on CookieYes. Whether you’re an Account Owner, Admin, or Editor, understanding these roles will help you efficiently manage cookie consent settings across your online properties.
How to Enable 2FA on CookieYes?
Просмотров 9221 день назад
Learn how to set up Two-Factor Authentication (2FA) on your CookieYes account. Enhance your security with these simple steps to enable 2FA, regenerate recovery codes, and disable 2FA, if needed. Check out our help guide: www.cookieyes.com/documentation/two-factor-authentication/?ref=2fa-yt
How to add cookie consent banner on Kajabi? - CookieYes
Просмотров 7621 день назад
Watch how you can add a cookie consent banner to your Kajabi website using the CookieYes web app. CookieYes' Google-certified CMP assists your Kajabi website to be cookie-compliant with privacy regulations such as GDPR, CCPA/CPRA, LGPD, POPIA, nFADP, PDPA, IAB TCF v2.2, etc. Get started with CookieYes for free: app.cookieyes.com/trial?plan=pro-monthly&ref=kajabi-yt Checkout our help guide: www....
How to add cookie consent banner on Weebly? - CookieYes
Просмотров 96Месяц назад
Watch how you can add a cookie consent banner to your Weebly website using the CookieYes web app. CookieYes' Google-certified CMP assists your Weebly website to be cookie-compliant with privacy regulations such as GDPR, CCPA/CPRA, LGPD, POPIA, nFADP, PDPA, IAB TCF v2.2, etc. Get started with CookieYes for free: app.cookieyes.com/trial?plan=pro-monthly&ref=weebly-yt Checkout our help guide: www....
How to Enable Subdomain Consent Sharing Using CookieYes?
Просмотров 92Месяц назад
Learn about CookieYes's Subdomain Consent Sharing feature! Share user consent seamlessly across all your website's subdomains, ensuring a smooth user experience and compliance with data privacy regulations, without repetitive consent banners. Check out our help guide: www.cookieyes.com/documentation/subdomain-consent-sharing/?ref=yt-scs
How to add cookie consent banner on Ghost? - CookieYes
Просмотров 53Месяц назад
Watch how you can add a cookie consent banner to your Ghost website using the CookieYes web app. CookieYes' Google-certified CMP assists your Ghost website to be cookie-compliant with privacy regulations such as GDPR, CCPA/CPRA, LGPD, POPIA, nFADP, PDPA, IAB TCF v2.2, etc. Get started with CookieYes for free: app.cookieyes.com/trial?plan=pro-monthly&ref=ghost-yt Checkout our help guide: www.coo...
How to Set Up Google Consent Mode With CookieYes?
Просмотров 1,3 тыс.Месяц назад
Learn how to easily and quickly implement Google Consent Mode v2 using CookieYes, the leading cookie management platform. For more details and custom GCM script for tag manager (Method 2), check out our help guide: www.cookieyes.com/documentation/implementing-google-consent-mode-using-cookieyes/?ref=yt-cygcm
How to Add a Cookie List to Any Webpage?
Просмотров 155Месяц назад
The GDPR mandates informing your European audience about the cookies used on your website, their purposes, usage, and the information they collect. A cookie audit table is a list of all cookies which informs visitors about cookie types, purposes, and specifications. CookieYes allows you to add this cookie list to your cookie consent banner or display them on any page of your website. Check out ...
How to integrate CookieYes using Google Tag Manager?
Просмотров 1,2 тыс.Месяц назад
Learn how to deploy CookieYes with Google Tag Manager in this step-by-step tutorial. For more details on consent settings and configuring third-party scripts, check the help guide: www.cookieyes.com/documentation/getting-started-with-google-tag-manager-and-cookieyes/?ref=yt-gtmcy Here's how you can implement Google Consent Mode using CookieYes and GTM: www.cookieyes.com/documentation/implementi...
How to use CookieYes for GDPR cookie compliance?
Просмотров 181Месяц назад
Navigating the complexities of GDPR for cookie compliance? CookieYes is here to help! Watch the video to see how CookieYes features can simplify your compliance journey. Read our detailed help guide for more: www.cookieyes.com/documentation/cookieyes-for-gdpr-cookie-compliance/?ref=yt-cygdpr
How to Add IAB TCF Cookie Banner Using CookieYes?
Просмотров 972 месяца назад
The IAB’s Transparency and Consent Framework (TCF) ensures transparency and compliance in digital advertising, particularly GDPR. If you target EU users, IAB TCF compliance is a must. CookieYes, registered and certified with the IAB, offers a simple solution to this, and here’s how you can implement it. For more information, read our help guide: www.cookieyes.com/documentation/iab-tcf-v2-2-comp...
How to record cookie consent using CookieYes?
Просмотров 2072 месяца назад
GDPR requires businesses to demonstrate proof of consent whenever necessary. This applies to websites that request user consent for using cookies. CookieYes provides an easy method to log consent without storing any personally identifiable information. In this guide, we'll show you how to utilize this feature. For more information, read our help guide: www.cookieyes.com/documentation/record-use...
How to use CookieYes for US State cookie compliance?
Просмотров 1682 месяца назад
How to use CookieYes for US State cookie compliance?
How to add a geo-targeting cookie banner using CookieYes?
Просмотров 1392 месяца назад
How to add a geo-targeting cookie banner using CookieYes?
How to set up cookie consent withdrawal with CookieYes?
Просмотров 1983 месяца назад
How to set up cookie consent withdrawal with CookieYes?
Navigating Consent Mode V2: How Should I Prepare? [Webinar 2] - CookieYes
Просмотров 2373 месяца назад
Navigating Consent Mode V2: How Should I Prepare? [Webinar 2] - CookieYes
How to customize cookie banner with CSS? - CookieYes
Просмотров 3493 месяца назад
How to customize cookie banner with CSS? - CookieYes
How to add a multilingual cookie banner using CookieYes?
Просмотров 2373 месяца назад
How to add a multilingual cookie banner using CookieYes?
How to avoid dark patterns in cookie consent? - CookieYes
Просмотров 1384 месяца назад
How to avoid dark patterns in cookie consent? - CookieYes
Navigating Consent Mode V2: How Should I Prepare? [Webinar] - CookieYes
Просмотров 6244 месяца назад
Navigating Consent Mode V2: How Should I Prepare? [Webinar] - CookieYes
How to connect Cookie Consent plugin to CookieYes app? [Updated]
Просмотров 6 тыс.5 месяцев назад
How to connect Cookie Consent plugin to CookieYes app? [Updated]
How to upgrade to Google Consent Mode v2 with CookieYes? [Updated]
Просмотров 3,8 тыс.5 месяцев назад
How to upgrade to Google Consent Mode v2 with CookieYes? [Updated]
How to add cookie consent banner to HTML websites? - CookieYes
Просмотров 2,2 тыс.5 месяцев назад
How to add cookie consent banner to HTML websites? - CookieYes
How to add cookie consent banner on React? - CookieYes
Просмотров 1,2 тыс.6 месяцев назад
How to add cookie consent banner on React? - CookieYes
What is GDPR Consent? - CookieYes
Просмотров 1,5 тыс.6 месяцев назад
What is GDPR Consent? - CookieYes
How to add cookie consent banner on Webflow? - CookieYes
Просмотров 2,1 тыс.7 месяцев назад
How to add cookie consent banner on Webflow? - CookieYes
How to add cookie consent to Shopify using app? - CookieYes
Просмотров 1,6 тыс.8 месяцев назад
How to add cookie consent to Shopify using app? - CookieYes
Rfr
If the user go to the subdomain before the main domain, does the cookieyes banner appear on the subdomain?
❤❤❤🇮🇳🇮🇳🇮🇳🇮🇳🇮🇳🇮🇳🇮🇳🇮🇳🇮🇳🇮🇳🇮🇳🇮🇳🇮🇳🇮🇳🇮🇳🇮🇳✈️✈️🛠🛠🛠⛴️⛴️⛴️🎡🎡🎡🚑🚑⛏️🚒⛏️⛏️🤟🤟🤟🌏🌏🌏🌐🌐🌐🛕🛕🛕🕉🛕🛕🕉🕉🎨🎨🎨🌆🌆🏗🏗🌇🌇🎡🌇🙋🙋🙋✌🏻✌🏻✌🏻✌🏻🌁🌁🌁✌🏻✌🏻🏞🏞🏞🎯🎯🧲🧲❣️❣️🦄🦄🦄🌉🌉🌉🙏🏻🙏🏻🙏🏻🌄🌄
❤❤❤🙏🏻🙏🏻🙏🏻🙏🏻🙏🏻🌄🌄🌄🦄🦄🦄❣️❣️❣️🧲🧲🧲🧲🎯🎯🎯🏞🏞🏞✌🏻✌🏻✌🏻✌🏻✌🏻🙋🙋🙋🤝❤️🔥❤️🔥🌁🌁🎨🎨🎨🌆🌆🏗🏗🌇🌇🎡🎡⛴️⛴️⛴️↗️↗️⛏️⛏️⚖️⚖️⚖️⚖️✅️✅️✅️🚧🚧🚧🤝❤️🔥❤️🔥🤝🤝🤝👍🏻👍🏻👍🏻👍🏻🚑🚒✈️✈️🛠🤟🤟🤟🤟🇮🇳🇮🇳🇮🇳🇮🇳🇮🇳🇮🇳🇮🇳🌏🌏🌏🌐🌐🛕🛕🛕🛕🕉🕉🕉
Yes I like it
Why there is no information about how to set regions exception with custom script? I saw this mentioning in GTM section, but it's ignored in custom script.
Thanks! Can you give more information on implementing GA4 after implementing Cookie Yes in GTM? Which Trigger should I use? Best,
You are not in the list from Google Tag Manager anymore, I tried to install it and your company is missing from that big list meaning from the Community Template Gallery. What should I do if I have a wordpress and want to install it correctly?
I’m confused as to why, after setting everything up you would choose to disconnect from the web app? I’ve heard GA4 traffic decreases substantially. Some say site speed is affected (negatively). How can this be avoided?
❤😂🎉😢 1:38
Followed the steps and worked great for me. Thanks!
How do you Unblock Google tags when using consent mode for a wordpress website using your plugin Cookiyes? When using the Google tag assistant no Google Tags were found, why? My website was already added into the Google Tag Manager. In addition, I already enabled the two options on my Cookieyes account for the Google consent mode (GCM). (My wordpress plugin is also updated) Also installed the Chrome Browser Extension to Microsoft Edge, I am having trouble finding how to place the specific custom script given to me from Cookiyes plugin step by step guide. -> "To integrate Google Consent Mode v2, the Copy the below custom script". I am using the Flatsome theme (UXBuilder), and in my settings to add custom scripts, there isn't a way to place them at specific locations for my website (I understand you need me to add the Custom Script BEFORE <Header> and Google Tag Manager Preview Scripts within the <Body>.
I've followed these steps using implementation method two for my WordPress site. I'm seeing a significant reduction in google analytics traffic and google adsense revenue. I have a free account with Cookie yes.
We have problems because the Debug view it's not possible to check if this it's working. The message that we have is this: Google Tag: GTM-WW48MS2 not found Please verify that the tag: Is installed on this page Is not being blocked (by a browser extension or a consent dialog)
how can i identify the id where i can log in my acc by pasting cookies)? (idk if this makes sense)
Are Cookiyes free or paid ?
We offer both free and paid plans. You can choose the plan based on your website size here: www.cookieyes.com/pricing/
Traducir español
THANKS
Worst tuto ever made.
Not understand
Could you please specify the part you need help with so we can assist you better?
Audrey mentioned that Google has a diagnostic tool to check if Consent mode V2 is active. Can you please give me the url where to find that tool? Thanks!
after install this plugin, ga4 traffic dropped why?
We require your website URL to check this. Please contact: wordpress.org/support/plugin/cookie-law-info/#new-topic-0 To help us resolve your issue faster, please include the following information in your email: Website URL : This helps us identify your specific website and provide relevant support. A detailed description of your query: The more specific you are, the better we can understand your problem and offer a solution. Screenshots or error messages (if applicable): Visual aids can be very helpful in troubleshooting technical issues.
after installation this plugin, my ga4 account traffic dropped why?
We require your website URL to check this. Please contact: wordpress.org/support/plugin/cookie-law-info/#new-topic-0 To help us resolve your issue faster, please include the following information in your email: Website URL : This helps us identify your specific website and provide relevant support. A detailed description of your query: The more specific you are, the better we can understand your problem and offer a solution. Screenshots or error messages (if applicable): Visual aids can be very helpful in troubleshooting technical issues.
Do I need to paste the code into the website and enable from tag manager or only one is enough ?
Only one is enough
Am I able to comply with Consent Mode using just the Wordpress plugin?
You should implement Consent Mode using method 2 while using the plugin to comply.
thank you
My Cookie Yes web app dashboard is blank. This means where I'm supposed to go to enable Google Consent Mode (GCM), it's not possible. I am on the free plugin in WordPress. Please, can you advise on this.
We've experienced a drop off in traffic which appears to stem from if users don't reject or accept the cookies and just continue to the use the site. We've just fixed the order of the scripts on our site, whereby previously the CookieYes implementation script was first. Would this explain why there was an issue with traffic not being tracked if they didn't accept or reject?
We require your website URL to check this. Please write to support@cookieyes.com. To help us resolve your issue faster, please include the following information in your email: Website URL : This helps us identify your specific website and provide relevant support. A detailed description of your query: The more specific you are, the better we can understand your problem and offer a solution. Screenshots or error messages (if applicable): Visual aids can be very helpful in troubleshooting technical issues.
Hi, did you manage to fix this problem? we're also experiencing the same problem sinds the last update, the visitors traffic has dropped off alot.
@@vitomathey5968 We require your website URL to check this. Please write to support@cookieyes.com. To help us resolve your issue faster, please include the following information in your email: Website URL : This helps us identify your specific website and provide relevant support. A detailed description of your query: The more specific you are, the better we can understand your problem and offer a solution. Screenshots or error messages (if applicable): Visual aids can be very helpful in troubleshooting technical issues.
@@vitomathey5968 We require your website URL to check this. Please write to support@cookieyes.com. To help us resolve your issue faster, please include the following information in your email: Website URL : This helps us identify your specific website and provide relevant support. A detailed description of your query: The more specific you are, the better we can understand your problem and offer a solution. Screenshots or error messages (if applicable): Visual aids can be very helpful in troubleshooting technical issues.
How can we verify if consent mode is correctly set up? Meaning data are not collected if consent is rejected?
How can I find the website key on the old wordpress plugin?
First, you should migrate from the old version to the revamped plugin version. After that, connect to CookieYes web app to find your website key. If you need assistance with the migration, please contact support: wordpress.org/support/plugin/cookie-law-info/#new-topic-0
no, it will not open the install pagek, it will open the cookieyes website and from there nothing works anymore! good job!
Could you please contact support and raise a ticket here: www.cookieyes.com/support/
IAB TC string Issue, European users, Error 7.8" We've detected an issue on your IAB TC string on one or more of your sites or apps. These errors may affect your ability to serve ads to European users. A detailed report is available for you on the EU user consent page. I can't figure out how to solve this. please tell me how to fix this.
Thanks for this easy to follow tutorial. How can we change the fonts of the privacy + cookie policies?
you guys are to expensive
fr
i might just make my own bad version
How do u ppt like this?
❤
❤😂🎉😢 ❤😂🎉😢 3:03
But then how do I add a link for these Policies on the banner?
Sorry for the late response. If you already have a CookieYes account, go to this link: app.cookieyes.com/customize Then, click on 'Content,' expand 'Cookie Notice,' and enable the “Cookie Policy” link toggle. Add the cookie policy URL under it, and then 'Publish changes.'
Dnmismangoodvidiokonsertpop60hndnpenysnyigoodmdjefrefindnmdarozamednpnanisdnpnnurameravidioputr24jmhareahadhingakhamisdnmismanodervidiopnnuramera918000putr24jjpadatahun2024vidiopnsemuadnvidiopndikonsertpop60hndnvidiopndjputr24jmdnvidiomdarozamesemuadipop60hnsemua34000putr24jmdnlagumdpop60hn34000dnlaguputrpadatahun2024dnputrlagupip60hnhareahadhingakhamispadajn9mlmhinga12mlmdnlagupnnurameeralagupopcintadnpopasmaradnpop60hndnpopsalomadnlagupnputr24jmhareahadhingakhamisdnlagusemuamismanoderlagupnnuramera918000putr24jmpadatahun2024dnlagupop60hndaremdjefredinlagusemuamismnoder34000putr pp adajm9mlmhiga12mlmdnhareahadhingakhamisdnlagusemua34000putrmlmdnvidiomdfikonsertpop60hnputrmlmjm9h8nga12mlmdnmismanmahuoderlagupnsnislagupopcintadnpopasmaradnpopdandutcintasemualagupnmismanoder917000putr24jmmulajm9mlmhinga1amdnpagijm10amhinga1140amdnpetangjm3hinga6petangtiaphareahadhingakhamisdnvidiopnanessemuavidiopndipop60hndnpopslowrocksemuavidiopnanesmismanoder917000putrpadatahun2024dnmisman MB ahuhadiahcarnisannevara1modeltahun2024dnpemilikcarmismanbinsamdnicnombor670908016153dncukaijln10tahundninsuran10tahuntakapolmalaysiadnboshntrcardialamatmismanbinsamdikampongseromnombor8dn84410sungaimatimuardnboscolmismn0193462405dnbosmasokwanghadiahvidiomismnsem7adiacauntnombor114160945017 mismanbinsamdnbnkmaymismndnic BN ombor670908016153mismanbinsamdnboshntrcarpadamusmncolmismn0193472405dnminmahuhadiahdatingfredengnpnnurameradnpnnuramerapadatahun2028denganmismndnpnanisdidubaiselama5tahunmulatahun2028hingatahun2032dnpnjadeisteremismnbaikselamanyadnpncolmnjo0193472405dnpnsoloserawak2 Melayudnpnjawatengh2melayupnsemuajadeisteremismnbaikdnpncolmismn0193472405dnbosfredatingpn6melayudidubaiselama6tahunmulatahuj2028hingatahun2033didubaidnbosfremaknadadnbilikada3dnshopingadatiapharednmaknadadntengokwayangadadnpergipantaidubaiadatiapharednrehatadadnmandiadadnmaknadadnbalikhosteltiapharednbosfrepasportmelancongpndating6melayuadadidubaidnmismnadapasportmelancongdubaiselama25tahununtukmismnbinsamdnbosfremismn pp asportdubai1dnbilik3dnmaknadadnshopingadadntengokwayangadatiapharedenganpndating6melayudnbosmasokwangshopingmismnbibsamdnwangodermakandnwanghadiahvidiomismansemuabosmasokwangdiacauntnombor16420900020616mismanbinsamdnbnkrhbmismanbinsamdnicnombor670908016153dnbosfremismanpasportmelancongdubaipadahb1buln1tahun2024hingatahun2047untukmismanadadnbilikada3dnmaknadadntengokwayangadatiapharedncar1bmw1adafrebiscolmismn0193472405dnbosfremasokwangshopingmismantiapbulnpadahb2tahun2024dpadatahun2025hb1buln1tahun2025tiapbulnadawangmasokrm4300tiapbulnhingatahun2047bosmasokwangtiapbulndntiaptahunadawangmasokmismanbinsamdnnomboracaunt16420900020616mismanbinsamdnbnkrhbmismanbinsamdnboshntrmesedwanghadiahmismn0193472405dnbosfreteketpesawatmasdengnpndatingadapn6dnmismnlelaki1afateketpergidnbalikdarekualalumporkedubaipadahb1dnhb30tiapbulnadateket7semuapesawatmasmalaysiadndubaiteketadadnboscolmismn0193472405teketmismnpadahb1buln1ttahun2025dnhb30adadibuln1tahun2025tiwpbulnadatiaptahunhingatahun2047tiketmismanadateketmas2adapergidnbalikadadnmaknadadnbilikada3dnshopingadadnwangshopingadamadokacauntmismndnbosfrepndatingmaknafadnshopingadadntengokwaysngadafnbilikada3dnwangshopingtiapbulnwangcasadarm2000untukpn6melayuadatiapbilnboskasewangpadahb1buln1tahun2028hingatahun2033dnpncolmismn0193472405dnbosfrepnteketpedawatmaspadahb1buln1tahun2028tiapbuln2xhb1dnhb30tiaptahunadahingatahun2033teketpesawatmasdarekualalumporkedubaipergidnbalikteketpesawatnasadahb1dnhb30untukpnadateketmaspesawatboskasepnteketada
Mnjogoodvidiojeretakarenmodelbarumismanodervidio23000putrpadatahun2024vidioputrhareahadhingakhsmis24jmvidio
😂
I saw everyone on stackoverflow said I should store user's shopping cart on db. Is this true?
Stupid EU laws
so good thanksss
why does your company's logo stay permanently on my home page when they click reject, as a reminder that they should click it? How can I disable this?
What about a multilingual site? How can we translate the cookies? Thanks
وب سایت رسمی دکتر شما هستی که با مفت خوری پرفسور میرزاخانی. اگه اشتباه کنم گناه من نبوده حق داری چون جای نیستی دیوانه انگل هرچه خوشحالت میکنه بگو اما نوبت رقص شتر میرسد ❤❤
That was ridiculously simple, thanks!
💕 "Promo SM"
music is annoying