- Видео 1 889
- Просмотров 1 348 808
Treasures Of Kuwait
Индия
Добавлен 23 сен 2020
Dear all,
Welcome to our channel TREASURES OF KUWAIT.
I am Lakshmi, a Carnatic musician by profession.
Here, I am sharing Authentic Kerala recipes, Tips & Tricks, Artworks & Vlogs from Kuwait.
Stay tuned for more videos....
Support me With Your Like, Share, Valuable Comments & Subscribe...
Welcome to our channel TREASURES OF KUWAIT.
I am Lakshmi, a Carnatic musician by profession.
Here, I am sharing Authentic Kerala recipes, Tips & Tricks, Artworks & Vlogs from Kuwait.
Stay tuned for more videos....
Support me With Your Like, Share, Valuable Comments & Subscribe...
weight loss smoothie/healthy smoothies for weight loss [smoothie recipes for weight loss]
#overnightoats#overnightoatsrecipe ,overnight oats,overnight oats for weight loss,overnight oats recipe,overnight oats protein,
overnight oats review,overnight oats alternative
overnight oats with chia seeds,overnight oats recipe for weight loss.oatsrecipe,diabeticrecipe,diabeticrecipemalaylam,dietrecipe,oats recipe,oatmeal recipe,healthy recipes,oats,overnight oats recipe,recipes,baked oats recipe,oats cake recipe,breakfast recipe,overnight oats,oatmeal recipes,oats recipes for weight loss,breakfast recipes,oats recipes,delicious recipe,cheap breakfast recipe,baked oats,cooking recipe,oats upma recipe,oats mango recipe,oats chila recipe,easy recipes,creative recipes,oats chilla recipe,rec...
overnight oats review,overnight oats alternative
overnight oats with chia seeds,overnight oats recipe for weight loss.oatsrecipe,diabeticrecipe,diabeticrecipemalaylam,dietrecipe,oats recipe,oatmeal recipe,healthy recipes,oats,overnight oats recipe,recipes,baked oats recipe,oats cake recipe,breakfast recipe,overnight oats,oatmeal recipes,oats recipes for weight loss,breakfast recipes,oats recipes,delicious recipe,cheap breakfast recipe,baked oats,cooking recipe,oats upma recipe,oats mango recipe,oats chila recipe,easy recipes,creative recipes,oats chilla recipe,rec...
Просмотров: 37
Видео
![overnight soaked oats recipes/overnight oats for weight loss [Easy & Healthy Recipes]](http://i.ytimg.com/vi/O9VgHRw-CJ0/mqdefault.jpg)
![overnight soaked oats recipes/overnight oats for weight loss [Easy & Healthy Recipes]](/img/tr.png)
overnight soaked oats recipes/overnight oats for weight loss [Easy & Healthy Recipes]
Просмотров 2074 часа назад
#overnightoats#overnightoatsrecipe ,overnight oats,overnight oats for weight loss,overnight oats recipe,overnight oats protein, overnight oats review,overnight oats alternative overnight oats with chia seeds,overnight oats recipe for weight loss.oatsrecipe,diabeticrecipe,diabeticrecipemalaylam,dietrecipe,oats recipe,oatmeal recipe,healthy recipes,oats,overnight oats recipe,recipes,baked oats re...
![ബ്രേക്ക്ഫാസ്റ്റ് സ്മൂത്തി/ how to make smoothie [high protein easy breakfast recipe]](http://i.ytimg.com/vi/QufBK0wB1dA/mqdefault.jpg)
ബ്രേക്ക്ഫാസ്റ്റ് സ്മൂത്തി/ how to make smoothie [high protein easy breakfast recipe]
Просмотров 31912 часов назад
oatsrecipe,diabeticrecipe,diabeticrecipemalaylam,dietrecipe,oats recipe,oatmeal recipe,healthy recipes,oats,overnight oats recipe,recipes,baked oats recipe,oats cake recipe,breakfast recipe,overnight oats,oatmeal recipes,oats recipes for weight loss,breakfast recipes,oats recipes,delicious recipe,cheap breakfast recipe,baked oats,cooking recipe,oats upma recipe,oats mango recipe,oats chila reci...
Kannur Cocktail Juice/ഇത്രയും ടേസ്റ്റ് ഉള്ള ഡ്രിങ്ക് കുടിച്ചിട്ടുണ്ടോ?Cocktail juice recipes
Просмотров 37614 часов назад
#kannur #banana ,#bananarecipe #bananashake #dessert #food #indianfood #recipe #cookingtips #healthyfood #cooking #cookingtricks #pazham #drink #summerdrinks #summer #colddrinks #ramadan #iftarrecipes #colddrinks #easydrinks #orange#pomegranate#ramadanrecipes#iftarrecipes#summerdrinks#refreshingdrinks#iftardrinks#ramadandrinks#fruitjuice#easyjuice#healthydrinkrecipe#sunrise#mocktail#summerdrink...
ചെറുപഴം ഉണ്ടോ?വിശപ്പും ദാഹവും മാറാൻ ഇതിനേക്കാൾ നല്ലൊരു ഡ്രിങ്ക് വേറെയില്ല/Cherupazham drink
Просмотров 12716 часов назад
#bananadrink #bananajuice #easydrinkrecipe #easyjuicerecipe,#sarbathrecipe,#banana ,#bananarecipe #bananamilkshake #summerspecial #cherupazhamdrink #bananashake #dessert #food #indianfood #recipe #cookingtips #healthyfood #cooking #cookingtricks #pazham #drink #summerdrinks #summer #colddrinks #ramadan #iftarrecipes #colddrinks #easydrinks #orange#pomegranate#ramadanrecipes#iftarrecipes#summerd...
![കൊഴുപ്പ് ഉരുകും സാലഡ് /Salad that burns belly fat [Healthy salad for weight loss]](http://i.ytimg.com/vi/rhannIPTkeg/mqdefault.jpg)
കൊഴുപ്പ് ഉരുകും സാലഡ് /Salad that burns belly fat [Healthy salad for weight loss]
Просмотров 18119 часов назад
#salad #saladrecipe ,salad fingers, #saladdressing ,salad recipes,salad recipes for weight loss,salad dressing with olive oil,salad dressing for weight loss, diet salad for weight loss,diet salad,salad for belly fat loss,diet salad for belly fat loss,vegetable salad for belly fat loss,best salad for belly fat fruit salad for belly fat loss salad recipes for belly fat loss salad for losing belly...
![ബ്രേക്ക്ഫാസ്റ്റ് സ്മൂത്തി/High Protein Breakfast Smoothie [easy breakfast]](http://i.ytimg.com/vi/hUV3rEgYPCE/mqdefault.jpg)
ബ്രേക്ക്ഫാസ്റ്റ് സ്മൂത്തി/High Protein Breakfast Smoothie [easy breakfast]
Просмотров 47521 час назад
oatsrecipe,diabeticrecipe,diabeticrecipemalaylam,dietrecipe,oats recipe,oatmeal recipe,healthy recipes,oats,overnight oats recipe,recipes,baked oats recipe,oats cake recipe,breakfast recipe,overnight oats,oatmeal recipes,oats recipes for weight loss,breakfast recipes,oats recipes,delicious recipe,cheap breakfast recipe,baked oats,cooking recipe,oats upma recipe,oats mango recipe,oats chila reci...
കയ്‌പില്ലാതെ പാവയ്ക്ക ഇങ്ങനെയൊന്ന് ട്രൈ ചെയ്ത് നോക്കൂ
Просмотров 159День назад
#pavakkatheeyal #pavakkaikulambu #pavalkrishipavakka,#bittergourd #bittergourdrecipe #bittergourdfry #bittergourdonion #bittergourdcurry #bittergourdpickle #bittergourdwithyogurt #bittergourdindreammeaning #bittergourdbenefits #bittergourdkisabzi #bittergourdrangolipavakkai pitlai pavakkai fry,bitter gourd benefits bitter gourd recipe bitter gourd juice bitter gourd juice benefits bitter gourd ...
നല്ലൊരു ഓംലെറ്റ് എങ്ങനെ ഉണ്ടാക്കാം /How to make a Perfect Omelette
Просмотров 282День назад
#eggrecipes,#omeletterecipe #eggrecipesindianstyle #eggrecipesintamil,egg recipes egg recipes in telugu egg recipes for breakfast egg recipes for dinner egg recipes indian style egg recipes in tamil egg recipes malayalam egg recipes for lunch egg recipes snacks,omelette recipe,omelette recipe indian omelette recipe in telugu omelette recipe malayalam
സോഫ്റ്റ് ആയ സ്പെഷ്യൽ പുട്ട്/corn flakes recipe malayalam
Просмотров 200День назад
#breakfastrecipe #breakfastrecipesinmalayalamecipes #foodie #foodblogger #food #kerala #traditional #diabeticdietmealplan #asmreating #recipes #cooking #recipe #snacksrecipe #foodrecipes #newrecipe #ricerecipe #nasta #snacks #cookingrecipes #breakfast#healthyfood #vegetarian #recipesforsnack #eveningsnacks #kerala #traditional #evening #nostalgia #pumpkin #shorts #live #youtube #funnyshorts #fu...
manga curry kerala style/pachamanga recipes in malayalam #food #cooking #mango #pickle
Просмотров 14714 дней назад
#howtomakepicklewithoutvinegar#pickles #keralastylemangopickle#mangopickle #rawmangopickle #instantmangopickle #picklerecipes #vishuspecial #easypickle #easyachar#spicypickle #mangaachar #sadhyaspecial #onamsadhyarecipe #nadanmangopickle#pachamangaachar#mangopicklerecipe #mango #rawmango #chammanthi #uppumanga #ഉപ്പുമാങ്ങ#curry #lunch #cooking #keralarecipes #ചമ്മന്തി#mangachammanthi #saltedten...
breakfast recipe malayalam/smoothie diet for weight loss #food #cooking #breakfast #smoothie
Просмотров 16214 дней назад
#breakfast recipe5 easy smoothie recipes #carrot,#banana, oats,oatmeal recipes,oats recipes for weight loss,breakfast recipes,oats recipes,delicious recipe,cheap breakfast recipe,baked oats,cooking recipe,oats upma recipe,oats mango recipe,oats chila recipe,easy recipes,creative recipes,oats chilla recipe,recipe in 5 minutes,quick recipes,oats breakfast recipe,overnightoats,oats recipe for weig...
പഞ്ഞി പോലെ സോഫ്റ്റ് ആയ ഗോതമ്പ് പുട്ട്
Просмотров 46721 день назад
#puttu#viral,#gothambuputtuputtu, recipe, coconut puttu, healthy breakfast ideas, traditional Kerala food, steamed rice cake, puttu maker tips, easy puttu preparation, puttu variations, vegan puttu recipes, puttu with banana,carrotputtu, healthybreakfast, southindianrecipes, steamedricecake, vegetarianrecipes, carrotrecipes, puttudish, easycooking, colorfulfood, comfortfood,breakfastideas, heal...
വാഴയില കേടുകൂടാതെ മാസങ്ങളോളം സൂക്ഷിക്കാം
Просмотров 28421 день назад
#tips #tipsandtricks #bananaleafcooking#bananaleaf #bananaleafdecoration#shorts #short #ytshorts #cooking #motivation#ytshorts #shorts #cookingtips #youtubeshorts #food#cookingtip#kitchentips #kitchentipsandtricks,#kitchentipsonline#kitchentipsinhindi#kitchentipsbyavikarawatfoods#kitchentipsintamil,#kitchen hacks #cooking tips #kitchen tricks #simple cooking #food tips #kitchen organization #qu...
ela ada recipe malayalam/ada recipe in malayalam
Просмотров 89121 день назад
ela ada recipe malayalam/ada recipe in malayalam
പോഷകഗുണവും രുചിയും ഒരുമിക്കുന്ന സോഫ്റ്റ് പുട്ട്
Просмотров 79921 день назад
പോഷകഗുണവും രുചിയും ഒരുമിക്കുന്ന സോഫ്റ്റ് പുട്ട്
നല്ല ആരോഗ്യത്തിന് ഓട്സ് ഇങ്ങനെ കഴിക്കൂ
Просмотров 63128 дней назад
നല്ല ആരോഗ്യത്തിന് ഓട്സ് ഇങ്ങനെ കഴിക്കൂ
അച്ചിങ്ങയും കായും ഇങ്ങനെയൊന്ന് തയ്യാറാക്കി നോക്കൂ
Просмотров 72928 дней назад
അച്ചിങ്ങയും കായും ഇങ്ങനെയൊന്ന് തയ്യാറാക്കി നോക്കൂ
Kitchen tips പൊടിക്കൈകൾ/useful kitchen tips Malayalam
Просмотров 323Месяц назад
Kitchen tips പൊടിക്കൈകൾ/useful kitchen tips Malayalam
High protein Oatmeal smoothie/ Healthy breakfast smoothie [Easy breakfast]
Просмотров 706Месяц назад
High protein Oatmeal smoothie/ Healthy breakfast smoothie [Easy breakfast]
ചക്ക അട ഇങ്ങനെ ഉണ്ടാക്കി നോക്കിട്ടുണ്ടോ/ chakka ada recipe Kerala style
Просмотров 598Месяц назад
ചക്ക അട ഇങ്ങനെ ഉണ്ടാക്കി നോക്കിട്ടുണ്ടോ/ chakka ada recipe Kerala style
Happy dussehra wishes/ happy vijayadashami/Happy dussehra WhatsApp status
Просмотров 91Месяц назад
Happy dussehra wishes/ happy vijayadashami/Happy dussehra WhatsApp status
Vrat recipes for Navratri/thrimadhuram recipe [prasadam recipes]
Просмотров 589Месяц назад
Vrat recipes for Navratri/thrimadhuram recipe [prasadam recipes]
വാഴയിലകൊണ്ട് ഇങ്ങനെയൊക്കെ പറ്റുമോ/ kitchen tips Malayalam
Просмотров 820Месяц назад
വാഴയിലകൊണ്ട് ഇങ്ങനെയൊക്കെ പറ്റുമോ/ kitchen tips Malayalam
The best way to cook Spinach ( kitchen tips)
Просмотров 29Месяц назад
The best way to cook Spinach ( kitchen tips)
How to store curry leaves [kitchen tips and tricks]
Просмотров 1,5 тыс.Месяц назад
How to store curry leaves [kitchen tips and tricks]
Easiest way to keep spinach fresh for longer ( kitchen tips)
Просмотров 63Месяц назад
Easiest way to keep spinach fresh for longer ( kitchen tips)
Knife/ kitchen tips ( tips and tricks)
Просмотров 83Месяц назад
Knife/ kitchen tips ( tips and tricks)
Healthy juice for Skin Glow & Hair growth [Amla juice for Hair fall control]
Просмотров 1,3 тыс.Месяц назад
Healthy juice for Skin Glow & Hair growth [Amla juice for Hair fall control]
L❤️. ഹെൽത്തി ഓട്സ് സ്മൂത്തി 👌👌❤️
Healthy Oats smoothie 💖💖💖💖
Athe overnight ithupole oats aaki vechal ravile oru healthy breakfast ready, super dear
Nalla healthy aayittila oats smoothie super aayittundu
helathy 👍
ഓട്സ് smoothie കൊള്ളാലോ ❤🎉
❤❤❤❤❤❤❤❤
Healthy and delicious recipe LK
ഹെൽത്തിയും ടേസ്റ്റിയുമായിട്ടുള്ള നല്ലൊരു റെസിപ്പിയാണ് കേട്ടോ ഒത്തിരി ഇഷ്ടപ്പെട്ടു അടിപൊളിയായിട്ടുണ്ട് Lk
വളരെ ഹെൽത്തി ആയിട്ടുള്ള ഒരു പ്രിപ്പറേഷൻ തന്നെയായിരുന്നു 😋
Oats vevikkande
@@JosejJ-gi1pj Venda, kurach time soak cheyth vechal mathy
Very healthy oats recipe 👌👍😍 L
Healthy recipe....😍
Easy recipes
They’re perfect for busy mornings!
Healthy ❤
healthy ❤️
നന്നായിട്ടുണ്ട് ❤👍
Healthy and delicious 😋
Healthy breakfast recipe ആണല്ലോ ❤❤❤
Healthy recipie ❤🎉
Healthy
Easy and healthy oats recipe 👌😋
overnight soaked oats have a healthy breakfast in the morning
👌🏻
👌🏻
Super healthy oats recipe, diet nokkunavarkku ithu super aanu👌😋
Healthy oats recipe.. 👍🏻
👍
👍
Hi me new subscriber ❤❤
Welcome!!
Look so delicious🎉🎉🎉
Thank you
Healthy & tasty smoothie recipe 👌🏻👌🏻 1month ayi oru emergency kkayi nattil anu.arudeyum visheshagal ariyan kazhinjilla
Saramilleda
@treasuresofkuwait 🥰
സ്മൂത്തി കൊള്ളാം ❤👍
Nice sharing
Super tasty and healthy smoothie...
L❤️. സൂപ്പർ സ്മൂത്തി ❤️❤️😋
Nalla healthy aayittulla smoothie, looks tasty and delicious
അടിപൊളി സ്മൂത്തി 👌😋
First 👍😍😍
Thank you for watching! 🙏
carrot should more and less of pappaya...in this video its just the opposite...thats why even the colour itself is not correct..it should look little more reddish
Tasty ആണല്ലോ സ്മൂത്തി 😋😋
Smoothie കൊള്ളാം ❤🎉👍
അടിപൊളി 🎉🎉🎉🎉🎉🎉
Smoothie Yummy And Tasty ഫുൾ വീഡിയോ വാച്ചിങ്ങ് ഇങ്ങോട്ടും വീഡിയോ കണ്ട് സപ്പോർട്ട് ചെയ്യണേ സുഹൃത്തുക്കളെ
wav super.healthy ingredients healthy smoothie and loved the way of your presentation
Good smoothie 👍
Healthy and delicious smoothie 💖💖💖
❤❤❤🤍🤍🤍🤍🤍
Woow ടേസ്റ്റി ആണല്ലോ dear😋